Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-DGKD AntibodyTitration: 1.0 ug/mlPositive Control: RPMI-8226 Whole Cell)

Rabbit DGKD Polyclonal Antibody | anti-DGKD antibody

DGKD Antibody - C-terminal region

Gene Names
DGKD; dgkd-2; DGKdelta
Reactivity
Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DGKD; Polyclonal Antibody; DGKD Antibody - C-terminal region; anti-DGKD antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KRSRSGKFRLVTKFKKEKNNKNKEAHSSLGAPVHLWGTEEVAAWLEHLSL
Sequence Length
1170
Applicable Applications for anti-DGKD antibody
Western Blot (WB)
Homology
Dog: 79%; Guinea Pig: 93%; Human: 100%; Mouse: 92%; Rabbit: 86%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human DGKD
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-DGKD AntibodyTitration: 1.0 ug/mlPositive Control: RPMI-8226 Whole Cell)

Western Blot (WB) (WB Suggested Anti-DGKD AntibodyTitration: 1.0 ug/mlPositive Control: RPMI-8226 Whole Cell)
Related Product Information for anti-DGKD antibody
This is a rabbit polyclonal antibody against DGKD. It was validated on Western Blot

Target Description: This gene encodes a cytoplasmic enzyme that phosphorylates diacylglycerol to produce phosphatidic acid. Diacylglycerol and phosphatidic acid are two lipids that act as second messengers in signaling cascades. Their cellular concentrations are regulated by the encoded protein, and so it is thought to play an important role in cellular signal transduction. Alternative splicing results in two transcript variants encoding different isoforms.
Product Categories/Family for anti-DGKD antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
130kDa
NCBI Official Full Name
diacylglycerol kinase delta isoform 1
NCBI Official Synonym Full Names
diacylglycerol kinase delta
NCBI Official Symbol
DGKD
NCBI Official Synonym Symbols
dgkd-2; DGKdelta
NCBI Protein Information
diacylglycerol kinase delta
UniProt Protein Name
Diacylglycerol kinase delta
Protein Family
UniProt Gene Name
DGKD
UniProt Synonym Gene Names
KIAA0145; DAG kinase delta; DGK-delta
UniProt Entry Name
DGKD_HUMAN

NCBI Description

This gene encodes a cytoplasmic enzyme that phosphorylates diacylglycerol to produce phosphatidic acid. Diacylglycerol and phosphatidic acid are two lipids that act as second messengers in signaling cascades. Their cellular concentrations are regulated by the encoded protein, and so it is thought to play an important role in cellular signal transduction. Alternative splicing results in two transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

DGKD: May function as signaling molecule. Belongs to the eukaryotic diacylglycerol kinase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Lipid Metabolism - glycerophospholipid; Lipid Metabolism - glycerolipid; Kinase, lipid; EC 2.7.1.107; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 2q37.1

Cellular Component: cytoplasmic membrane-bound vesicle; cytoplasm; plasma membrane

Molecular Function: diacylglycerol binding; protein binding; protein homodimerization activity; protein heterodimerization activity; metal ion binding; diacylglycerol kinase activity; ATP binding; NAD+ kinase activity

Biological Process: epidermal growth factor receptor signaling pathway; second-messenger-mediated signaling; platelet activation; multicellular organismal development; endocytosis; signal transduction; response to organic substance; protein transport; protein kinase C activation; diacylglycerol metabolic process; blood coagulation; cell growth; phosphorylation; protein homooligomerization

Research Articles on DGKD

Similar Products

Product Notes

The DGKD dgkd (Catalog #AAA3216983) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DGKD Antibody - C-terminal region reacts with Dog, Guinea Pig, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DGKD can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DGKD dgkd for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KRSRSGKFRL VTKFKKEKNN KNKEAHSSLG APVHLWGTEE VAAWLEHLSL. It is sometimes possible for the material contained within the vial of "DGKD, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.