Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using DGKD antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 5s.)
Rabbit anti-Human DGKD Polyclonal Antibody | anti-DGKD antibody
DGKD Polyclonal Antibody
Gene Names
DGKD; dgkd-2; DGKdelta
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
DGKD; Polyclonal Antibody; DGKD Polyclonal Antibody; dgkd-2; DGKdelta; anti-DGKD antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
LPRPPSCSLHPEMLSEEEATQMDQFGQAAGVLIHSIREIAQSHRDMEQELAHAVNASSKSMDRVYGKPRTTEGLNCSFVLEMVNNFRALRSETELLLSGKMALQLDPPQKEQLGSALAEMDRQLRRLADTPWLCQSAEPGDEESVMLDLAKRSRSGKFRLVTKFKKEKNNKNKEAHSSLGA
Sequence Length
1170
Applicable Applications for anti-DGKD antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human DGKD
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cytoplasm, Membrane, Peripheral membrane protein
Positive Samples
Raji, HepG2
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using DGKD antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 5s.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using DGKD antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 5s.)
Related Product Information for anti-DGKD antibody
This gene encodes a cytoplasmic enzyme that phosphorylates diacylglycerol to produce phosphatidic acid. Diacylglycerol and phosphatidic acid are two lipids that act as second messengers in signaling cascades. Their cellular concentrations are regulated by the encoded protein, and so it is thought to play an important role in cellular signal transduction. Alternative splicing results in two transcript variants encoding different isoforms.
Product Categories/Family for anti-DGKD antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 130kDa; 134kDa
Observed: 160kDa
Observed: 160kDa
NCBI Official Full Name
diacylglycerol kinase delta isoform 1
NCBI Official Synonym Full Names
diacylglycerol kinase delta
NCBI Official Symbol
DGKD
NCBI Official Synonym Symbols
dgkd-2; DGKdelta
NCBI Protein Information
diacylglycerol kinase delta
UniProt Protein Name
Diacylglycerol kinase delta
Protein Family
UniProt Gene Name
DGKD
UniProt Synonym Gene Names
KIAA0145; DAG kinase delta; DGK-delta
NCBI Description
This gene encodes a cytoplasmic enzyme that phosphorylates diacylglycerol to produce phosphatidic acid. Diacylglycerol and phosphatidic acid are two lipids that act as second messengers in signaling cascades. Their cellular concentrations are regulated by the encoded protein, and so it is thought to play an important role in cellular signal transduction. Alternative splicing results in two transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
Uniprot Description
May function as signaling molecule.
Research Articles on DGKD
Similar Products
Product Notes
The DGKD dgkd (Catalog #AAA9135101) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DGKD Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DGKD can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the DGKD dgkd for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LPRPPSCSLH PEMLSEEEAT QMDQFGQAAG VLIHSIREIA QSHRDMEQEL AHAVNASSKS MDRVYGKPRT TEGLNCSFVL EMVNNFRALR SETELLLSGK MALQLDPPQK EQLGSALAEM DRQLRRLADT PWLCQSAEPG DEESVMLDLA KRSRSGKFRL VTKFKKEKNN KNKEAHSSLG A. It is sometimes possible for the material contained within the vial of "DGKD, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
