Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human DGKA Polyclonal Antibody | anti-DGKA antibody

DGKA (Diacylglycerol Kinase alpha, Diglyceride Kinase alpha, DGK-alpha, DAG Kinase alpha, 80kD Diacylglycerol Kinase, DAGK, DAGK1) (MaxLight 490)

Gene Names
DGKA; DAGK; DAGK1; DGK-alpha
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DGKA; Polyclonal Antibody; DGKA (Diacylglycerol Kinase alpha; Diglyceride Kinase alpha; DGK-alpha; DAG Kinase alpha; 80kD Diacylglycerol Kinase; DAGK; DAGK1) (MaxLight 490); anti-DGKA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human DGKA.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-DGKA antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human DGKA, aa1-735 (NP_001336.2).
Immunogen Sequence
MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAKYVQGDAIGYEGFQQFLKIYLEVDNVPRHLSLALFQSFETGHCLNETNVTKDVVCLNDVSCYFSLLEGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSELRPILQEMMKEIDYDGSGSVSQAEWVRAGATTVPLLVLLGLEMTLKDDGQHMWRPKRFPRPVYCNLCESSIGLGKQGLSCNLCKYTVHDQCAMKALPCEVSTYAKSRKDIGVQSHVWVRGGCESGRCDRCQKKIRIYHSLTGLHCVWCHLEIHDDCLQAVGHECDCGLLRDHILPPSSIYPSVLASGPDRKNSKTSQKTMDDLNLSTSEALRIDPVPNTHPLLVFVNPKSGGKQGQRVLWKFQYILNPRQVFNLLKDGPEIGLRLFKDVPDSRILVCGGDGTVGWILETIDKANLPVLPPVAVLPLGTGNDLARCLRWGGGYEGQNLAKILKDLEMSKVVHMDRWSVEVIPQQTEEKSDPVPFQIINNYFSIGVDASIAHRFHIMREKYPEKFNSRMKNKLWYFEFATSESIFSTCKKLEESLTVEICGKPLDLSNLSLEGIAVLNIPSMHGGSNLWGDTRRPHGDIYGINQALGATAKVITDPDILKTCVPDLSDKRLEVVGLEGAIEMGQIYTKLKNAGRRLAKCSEITFHTTKTLPMQIDGEPWMQTPCTIKITHKNQMPMLMGPPPRSTNFFGFLS
Conjugate
MaxLight490
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-DGKA antibody
DGK-a is an 80kD, 735aa, type I member of the eukaryocytic diacylglycerol kinase family of enzymes, possessing EF-hand, C1/Cys-rich zinc finger and catalytic domains. In T cells, IL-2 stimulates its translocation to the nucleus, promoting proliferation. TCR stimulation, however, promotes migration to the plasma membrane to downregulate RAS activation and maintain anergy. It also participates in VEGF or HGF-mediated motility in endothelial, epithelial, or cancer cells. Over aa1-162, which includes the first of two EF-hand motifs, human DGK-a shares 75aa identity with mouse and rat DGK-a.
Product Categories/Family for anti-DGKA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
82,630 Da
NCBI Official Full Name
diacylglycerol kinase alpha
NCBI Official Synonym Full Names
diacylglycerol kinase, alpha 80kDa
NCBI Official Symbol
DGKA
NCBI Official Synonym Symbols
DAGK; DAGK1; DGK-alpha
NCBI Protein Information
diacylglycerol kinase alpha; DAG kinase alpha; diglyceride kinase alpha; 80 kDa diacylglycerol kinase
UniProt Protein Name
Diacylglycerol kinase alpha
Protein Family
UniProt Gene Name
DGKA
UniProt Synonym Gene Names
DAGK; DAGK1; DAG kinase alpha; DGK-alpha
UniProt Entry Name
DGKA_HUMAN

NCBI Description

The protein encoded by this gene belongs to the eukaryotic diacylglycerol kinase family. It acts as a modulator that competes with protein kinase C for the second messenger diacylglycerol in intracellular signaling pathways. It also plays an important role in the resynthesis of phosphatidylinositols and phosphorylating diacylglycerol to phosphatidic acid. Alternative splicing occurs at this locus and four transcript variants encoding the same protein have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

DGKA: Upon cell stimulation converts the second messenger diacylglycerol into phosphatidate, initiating the resynthesis of phosphatidylinositols and attenuating protein kinase C activity. Monomer. Lymphocytes and oligodendroglial cells. Stimulated by calcium and phosphatidylserine. Phosphorylated by protein kinase C. Belongs to the eukaryotic diacylglycerol kinase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Kinase, lipid; EC 2.7.1.107; Motility/polarity/chemotaxis; Lipid Metabolism - glycerophospholipid; Lipid Metabolism - glycerolipid

Chromosomal Location of Human Ortholog: 12q13.3

Cellular Component: membrane; plasma membrane; cytosol

Molecular Function: phospholipid binding; calcium ion binding; diacylglycerol kinase activity; ATP binding; NAD+ kinase activity

Biological Process: platelet activation; protein kinase C activation; blood coagulation; phosphorylation

Research Articles on DGKA

Similar Products

Product Notes

The DGKA dgka (Catalog #AAA6376079) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DGKA (Diacylglycerol Kinase alpha, Diglyceride Kinase alpha, DGK-alpha, DAG Kinase alpha, 80kD Diacylglycerol Kinase, DAGK, DAGK1) (MaxLight 490) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DGKA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DGKA dgka for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DGKA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.