Rabbit anti-Human DGKA Polyclonal Antibody | anti-DGKA antibody

DGKA (Diacylglycerol Kinase alpha, Diglyceride Kinase alpha, DGK-alpha, DAG Kinase alpha, 80kD Diacylglycerol Kinase, DAGK, DAGK1) (PE)

Cat. Num. AAA6376083

• Gene Names: DGKA; DAGK; DAGK1; DGK-alpha
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: DGKA; Polyclonal Antibody; DGKA (Diacylglycerol Kinase alpha; Diglyceride Kinase alpha; DGK-alpha; DAG Kinase alpha; 80kD Diacylglycerol Kinase; DAGK; DAGK1) (PE); anti-DGKA antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human DGKA.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-DGKA antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human DGKA, aa1-735 (NP_001336.2).
• Immunogen Sequence: MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAKYVQGDAIGYEGFQQFLKIYLEVDNVPRHLSLALFQSFETGHCLNETNVTKDVVCLNDVSCYFSLLEGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSELRPILQEMMKEIDYDGSGSVSQAEWVRAGATTVPLLVLLGLEMTLKDDGQHMWRPKRFPRPVYCNLCESSIGLGKQGLSCNLCKYTVHDQCAMKALPCEVSTYAKSRKDIGVQSHVWVRGGCESGRCDRCQKKIRIYHSLTGLHCVWCHLEIHDDCLQAVGHECDCGLLRDHILPPSSIYPSVLASGPDRKNSKTSQKTMDDLNLSTSEALRIDPVPNTHPLLVFVNPKSGGKQGQRVLWKFQYILNPRQVFNLLKDGPEIGLRLFKDVPDSRILVCGGDGTVGWILETIDKANLPVLPPVAVLPLGTGNDLARCLRWGGGYEGQNLAKILKDLEMSKVVHMDRWSVEVIPQQTEEKSDPVPFQIINNYFSIGVDASIAHRFHIMREKYPEKFNSRMKNKLWYFEFATSESIFSTCKKLEESLTVEICGKPLDLSNLSLEGIAVLNIPSMHGGSNLWGDTRRPHGDIYGINQALGATAKVITDPDILKTCVPDLSDKRLEVVGLEGAIEMGQIYTKLKNAGRRLAKCSEITFHTTKTLPMQIDGEPWMQTPCTIKITHKNQMPMLMGPPPRSTNFFGFLS
• Conjugate: PE
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(DGKA rabbit polyclonal antibody. Western Blot analysis of DGKA expression in human placenta.)

Western Blot (WB)

(DGKA rabbit polyclonal antibody. Western Blot analysis of DGKA expression in K-562.)

Western Blot (WB)

(Western Blot analysis of DGKA expression in transfected 293T cell line by DGKA polyclonal antibody. Lane 1: DGKA transfected lysate (82.6kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-DGKA antibody

DGK-a is an 80kD, 735aa, type I member of the eukaryocytic diacylglycerol kinase family of enzymes, possessing EF-hand, C1/Cys-rich zinc finger and catalytic domains. In T cells, IL-2 stimulates its translocation to the nucleus, promoting proliferation. TCR stimulation, however, promotes migration to the plasma membrane to downregulate RAS activation and maintain anergy. It also participates in VEGF or HGF-mediated motility in endothelial, epithelial, or cancer cells. Over aa1-162, which includes the first of two EF-hand motifs, human DGK-a shares 75aa identity with mouse and rat DGK-a.

Product Categories/Family for anti-DGKA antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 31542504
• NCBI GeneID: 1606
• NCBI Accession #: NP_001336.2
• NCBI GenBank Nucleotide #: NM_001345
• UniProt Accession #: P23743; O75481; O75482; O75483; O95217; Q8IZ56; Q8N5Q2
• Molecular Weight: 82,630 Da
• NCBI Official Full Name: diacylglycerol kinase alpha
• NCBI Official Synonym Full Names: diacylglycerol kinase, alpha 80kDa
• NCBI Official Symbol: DGKA
• NCBI Official Synonym Symbols: DAGK; DAGK1; DGK-alpha
• NCBI Protein Information: diacylglycerol kinase alpha; DAG kinase alpha; diglyceride kinase alpha; 80 kDa diacylglycerol kinase
• UniProt Protein Name: Diacylglycerol kinase alpha
• Protein Family: Diacylglycerol kinase
• UniProt Gene Name: DGKA
• UniProt Synonym Gene Names: DAGK; DAGK1; DAG kinase alpha; DGK-alpha
• UniProt Entry Name: DGKA_HUMAN

NCBI Description

The protein encoded by this gene belongs to the eukaryotic diacylglycerol kinase family. It acts as a modulator that competes with protein kinase C for the second messenger diacylglycerol in intracellular signaling pathways. It also plays an important role in the resynthesis of phosphatidylinositols and phosphorylating diacylglycerol to phosphatidic acid. Alternative splicing occurs at this locus and four transcript variants encoding the same protein have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

DGKA: Upon cell stimulation converts the second messenger diacylglycerol into phosphatidate, initiating the resynthesis of phosphatidylinositols and attenuating protein kinase C activity. Monomer. Lymphocytes and oligodendroglial cells. Stimulated by calcium and phosphatidylserine. Phosphorylated by protein kinase C. Belongs to the eukaryotic diacylglycerol kinase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Kinase, lipid; EC 2.7.1.107; Motility/polarity/chemotaxis; Lipid Metabolism - glycerophospholipid; Lipid Metabolism - glycerolipid

Chromosomal Location of Human Ortholog: 12q13.3

Cellular Component: membrane; plasma membrane; cytosol

Molecular Function: phospholipid binding; calcium ion binding; diacylglycerol kinase activity; ATP binding; NAD+ kinase activity

Biological Process: platelet activation; protein kinase C activation; blood coagulation; phosphorylation