Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (41.73kD).)

Mouse anti-Human TXNL4A Monoclonal Antibody | anti-TXNL4A antibody

TXNL4A (Thioredoxin-like Protein 4A, TXNL4, DIB1, DIM1 Protein Homolog, DIM1, Spliceosomal U5 snRNP-specific 15kD Protein, Thioredoxin-like U5 snRNP Protein U5-15kD) (PE)

Gene Names
TXNL4A; BMKS; DIB1; DIM1; TXNL4; SNRNP15; U5-15kD
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TXNL4A; Monoclonal Antibody; TXNL4A (Thioredoxin-like Protein 4A; TXNL4; DIB1; DIM1 Protein Homolog; DIM1; Spliceosomal U5 snRNP-specific 15kD Protein; Thioredoxin-like U5 snRNP Protein U5-15kD) (PE); HsT161; U5-15kD; anti-TXNL4A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1C4
Specificity
Recognizes human TXNL4A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-TXNL4A antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-142 from human TXNL4A (AAH01046) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSTKYRY
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (41.73kD).)

Western Blot (WB) (Western Blot detection against Immunogen (41.73kD).)

Western Blot (WB)

(Western Blot analysis of TXNL4A expression in transfected 293T cell line by TXNL4A monoclonal antibody Lane 1: TXNL4A transfected lysate (16.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of TXNL4A expression in transfected 293T cell line by TXNL4A monoclonal antibody Lane 1: TXNL4A transfected lysate (16.8kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged TXNL4A is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged TXNL4A is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-TXNL4A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
16,786 Da
NCBI Official Full Name
Homo sapiens thioredoxin-like 4A, mRNA
NCBI Official Synonym Full Names
thioredoxin like 4A
NCBI Official Symbol
TXNL4A
NCBI Official Synonym Symbols
BMKS; DIB1; DIM1; TXNL4; SNRNP15; U5-15kD
NCBI Protein Information
thioredoxin-like protein 4A
Protein Family

NCBI Description

The protein encoded by this gene is a member of the U5 small ribonucleoprotein particle (snRNP), and is involved in pre-mRNA splicing. This protein contains a thioredoxin-like fold and it is expected to interact with multiple proteins. Protein-protein interactions have been observed with the polyglutamine tract-binding protein 1 (PQBP1). Mutations in both the coding region and promoter region of this gene have been associated with Burn-McKeown syndrome, which is a rare disorder characterized by craniofacial dysmorphisms, cardiac defects, hearing loss, and bilateral choanal atresia. A pseudogene of this gene is found on chromosome 2. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2015]

Research Articles on TXNL4A

Similar Products

Product Notes

The TXNL4A (Catalog #AAA6160912) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TXNL4A (Thioredoxin-like Protein 4A, TXNL4, DIB1, DIM1 Protein Homolog, DIM1, Spliceosomal U5 snRNP-specific 15kD Protein, Thioredoxin-like U5 snRNP Protein U5-15kD) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TXNL4A can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TXNL4A for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TXNL4A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.