Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of DEFA6 expression in transfected 293T cell line by MBS641143. Lane 1: DEFA6 transfected lysate (11kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human DEFA6 Polyclonal Antibody | anti-DEFA6 antibody

DEFA6 (Defensin-6, Defensin, alpha 6, DEF6)

Gene Names
DEFA6; DEF6; HD-6
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
DEFA6; Polyclonal Antibody; DEFA6 (Defensin-6; Defensin; alpha 6; DEF6); Anti -DEFA6 (Defensin-6; anti-DEFA6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human DEFA6.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Concentration
0.5mg/mL (varies by lot)
Sequence
MRTLTILTAVLLVALQAKAEPLQAEDDPLQAKAYEADAQEQRGANDQDFAVSFAEDASSSLRALGSTRAFTCHCRRSCYSTEYSYGTCTVMGINHRFCCL
Applicable Applications for anti-DEFA6 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length protein corresponding to aa 1-100 of human DEFA6
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of DEFA6 expression in transfected 293T cell line by MBS641143. Lane 1: DEFA6 transfected lysate (11kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of DEFA6 expression in transfected 293T cell line by MBS641143. Lane 1: DEFA6 transfected lysate (11kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-DEFA6 antibody
Has very low antimicrobial activity against Gram-negative and Gram-positive bacteria. May protect cells against infection with HIV-1.
Product Categories/Family for anti-DEFA6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
defensin-6 preproprotein
NCBI Official Synonym Full Names
defensin, alpha 6, Paneth cell-specific
NCBI Official Symbol
DEFA6
NCBI Official Synonym Symbols
DEF6; HD-6
NCBI Protein Information
defensin-6; defensin 6
UniProt Protein Name
Defensin-6
Protein Family
UniProt Gene Name
DEFA6
UniProt Synonym Gene Names
DEF6
UniProt Entry Name
DEF6_HUMAN

NCBI Description

Defensins are a family of microbicidal and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. Several alpha defensin genes appear to be clustered on chromosome 8. The protein encoded by this gene, defensin, alpha 6, is highly expressed in the secretory granules of Paneth cells of the small intestine, and likely plays a role in host defense of human bowel. [provided by RefSeq, Jul 2008]

Uniprot Description

defensin, alpha 6: Has very low antimicrobial activity against Gram- negative and Gram-positive bacteria. May protect cells against infection with HIV-1. Belongs to the alpha-defensin family.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 8p23.1

Cellular Component: extracellular space; Golgi lumen; extracellular region

Biological Process: killing of cells of another organism; antibacterial humoral response; innate immune response; defense response to fungus

Research Articles on DEFA6

Similar Products

Product Notes

The DEFA6 defa6 (Catalog #AAA641143) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DEFA6 (Defensin-6, Defensin, alpha 6, DEF6) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DEFA6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the DEFA6 defa6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MRTLTILTAV LLVALQAKAE PLQAEDDPLQ AKAYEADAQE QRGANDQDFA VSFAEDASSS LRALGSTRAF TCHCRRSCYS TEYSYGTCTV MGINHRFCCL. It is sometimes possible for the material contained within the vial of "DEFA6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.