Rabbit anti-Mouse, Rat DDX27 Polyclonal Antibody | anti-DDX27 antibody
DDX27 Polyclonal Antibody
Gene Names
DDX27; DRS1; RHLP; Drs1p; PP3241; HSPC259; dJ686N3.1
Reactivity
Mouse, Rat
Applications
Immunohistochemistry
Purity
Affinity Purification
Synonyms
DDX27; Polyclonal Antibody; DDX27 Polyclonal Antibody; dJ686N3.1; DRS1; Drs1p; HSPC259; PP3241; RHLP; anti-DDX27 antibody
Host
Rabbit
Reactivity
Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
KARILPQDVILKFRDKIEKMEKDVYAVLQLEAEEKEMQQSEAQINTAKRLLEKGKEAVVQEPERSWFQTKEERKKEKIAKALQEFDLALRGKKKRKKFMKDAKKKGEMTAEERSQFEILKAQMFAERLAKRNRRAKRARAMPEEEPVRGPAKKQKQGKKSVFDEELTNTSKKALKQYRAGPSFEERKQLGLPHQRRGGNFKSKSRYKRRK
Sequence Length
796
Applicable Applications for anti-DDX27 antibody
Immunohistochemistry (IHC)
Application Notes
IHC: 1:50 - 1:200
Immunogen
Recombinant protein of human DDX27
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Related Product Information for anti-DDX27 antibody
DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein involved in the processing of 5.8S and 28S ribosomal RNAs. More specifically, the encoded protein localizes to the nucleolus, where it interacts with the PeBoW complex to ensure proper 3' end formation of 47S rRNA.
Product Categories/Family for anti-DDX27 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
89kDa
NCBI Official Full Name
probable ATP-dependent RNA helicase DDX27 isoform 2
NCBI Official Synonym Full Names
DEAD-box helicase 27
NCBI Official Symbol
DDX27
NCBI Official Synonym Symbols
DRS1; RHLP; Drs1p; PP3241; HSPC259; dJ686N3.1
NCBI Protein Information
probable ATP-dependent RNA helicase DDX27
UniProt Protein Name
Probable ATP-dependent RNA helicase DDX27
Protein Family
UniProt Gene Name
DDX27
NCBI Description
DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein involved in the processing of 5.8S and 28S ribosomal RNAs. More specifically, the encoded protein localizes to the nucleolus, where it interacts with the PeBoW complex to ensure proper 3' end formation of 47S rRNA. [provided by RefSeq, Jan 2017]
Uniprot Description
Probable ATP-dependent RNA helicase. Component of the nucleolar ribosomal RNA (rRNA) processing machinery that regulates 3' end formation of ribosomal 47S rRNA (PubMed:25825154).
Research Articles on DDX27
Similar Products
Product Notes
The DDX27 ddx27 (Catalog #AAA9134903) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DDX27 Polyclonal Antibody reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DDX27 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC). IHC: 1:50 - 1:200. Researchers should empirically determine the suitability of the DDX27 ddx27 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: KARILPQDVI LKFRDKIEKM EKDVYAVLQL EAEEKEMQQS EAQINTAKRL LEKGKEAVVQ EPERSWFQTK EERKKEKIAK ALQEFDLALR GKKKRKKFMK DAKKKGEMTA EERSQFEILK AQMFAERLAK RNRRAKRARA MPEEEPVRGP AKKQKQGKKS VFDEELTNTS KKALKQYRAG PSFEERKQLG LPHQRRGGNF KSKSRYKRRK. It is sometimes possible for the material contained within the vial of "DDX27, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
