Rabbit anti-Human DCTD Polyclonal Antibody | anti-DCTD antibody

DCTD (Deoxycytidylate Deaminase, dCMP Deaminase) (Biotin)

Cat. Num. AAA6375756

• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: DCTD; Polyclonal Antibody; DCTD (Deoxycytidylate Deaminase; dCMP Deaminase) (Biotin); anti-DCTD antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human DCTD.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-DCTD antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human DCTD, aa1-189 (NP_001012750.1).
• Immunogen Sequence: MVGGGQPCGPNMSEVSCKKRDDYLEWPEYFMAVAFLSAQRSKDPNSQVGACIVNSENKIVGIGYNGMPNGCSDDVLPWRRTAENKLDTKYPYVCHAELNAIMNKNSTDVKGCSMYVALFPCNECAKLIIQAGIKEVIFMSDKYHDSDEATAARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKLQ
• Conjugate: Biotin
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of DCTD expression in transfected 293T cell line by DCTD polyclonal antibody. Lane 1: DCTD transfected lysate (21kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-DCTD antibody

Deoxycytidylate deaminase (DCTD; EC 3.5.4.12) catalyzes the deamination of dCMP to dUMP, thus providing the nucleotide substrate for thymidylate synthase (MIM 188350). DCTD is allosterically activated by dCTP and inhibited by dTTP [supplied by OMIM].

Product Categories/Family for anti-DCTD antibody

Antibodies; Enzymes

NCBI and Uniprot Product Information

• NCBI GI #: 61742821
• NCBI GeneID: 1635
• NCBI Accession #: NP_001012750.1
• NCBI GenBank Nucleotide #: NM_001012732.1
• UniProt Accession #: P32321; Q5M7Z8; Q9BVD8; B2R836; D3DP49; D3DP50
• Molecular Weight: 21,014 Da
• NCBI Official Full Name: deoxycytidylate deaminase isoform a
• NCBI Official Synonym Full Names: dCMP deaminase
• NCBI Official Symbol: DCTD
• NCBI Protein Information: deoxycytidylate deaminase
• UniProt Protein Name: Deoxycytidylate deaminase
• Protein Family: Deoxycytidylate deaminase
• UniProt Gene Name: DCTD
• UniProt Entry Name: DCTD_HUMAN

NCBI Description

The protein encoded by this gene catalyzes the deamination of dCMP to dUMP, the nucleotide substrate for thymidylate synthase. The encoded protein is allosterically activated by dCTP and inhibited by dTTP, and is found as a homohexamer. This protein uses zinc as a cofactor for its activity. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

DCTD: catalyzes the deamination of dCMP to dUMP, thus providing the nucleotide substrate for thymidylate synthase. Allosteric enzyme whose activity is greatly influenced by the end products of its metabolic pathway, dCTP and dTTP.

Protein type: Nucleotide Metabolism - pyrimidine; EC 3.5.4.12; Hydrolase

Chromosomal Location of Human Ortholog: 4q35.1

Cellular Component: cytosol

Molecular Function: zinc ion binding; dCMP deaminase activity

Biological Process: pyrimidine base metabolic process; nucleobase, nucleoside and nucleotide metabolic process; pyrimidine nucleotide metabolic process; nucleotide biosynthetic process; pyrimidine nucleoside biosynthetic process