Mouse PCMT1 Monoclonal Antibody | anti-PCMT1 antibody

PCMT1 (Protein-L-isoaspartate(D-aspartate) O-methyltransferase, PIMT, Protein-beta-Aspartate Methyltransferase, Protein L-isoaspartyl/D-aspartyl Methyltransferase, L-isoaspartyl Protein Carboxyl Methyltransferase) (AP)

Cat. Num. AAA6132827

• Gene Names: PCMT1; PIMT
• Reactivity: Human, Mouse, Rat
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PCMT1; Monoclonal Antibody; PCMT1 (Protein-L-isoaspartate(D-aspartate) O-methyltransferase; PIMT; Protein-beta-Aspartate Methyltransferase; Protein L-isoaspartyl/D-aspartyl Methyltransferase; L-isoaspartyl Protein Carboxyl Methyltransferase) (AP); anti-PCMT1 antibody

• Host: Mouse
• Reactivity: Human, Mouse, Rat
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1D6
• Specificity: Recognizes human PCMT1. Species Crossreactivity: mouse and rat.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-PCMT1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa117-226 from human PCMT1 (NP_005380) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: DDSVNNVRKDDPTLLSSGRVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPAGGNQMLEQYDKLQDGSIKMKPLMGVIYVPLTDKEKQWSR
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.73kD).)

Western Blot (WB)

(PCMT1 monoclonal antibody Western Blot analysis of PCMT1 expression in HeLa.)

Western Blot (WB)

(PCMT1 monoclonal antibody. Western Blot analysis of PCMT1 expression in PC-12.)

Western Blot (WB)

(PCMT1 monoclonal antibody. Western Blot analysis of PCMT1 expression in Raw 264.7.)

Western Blot (WB)

(PCMT1 monoclonal antibody. Western Blot analysis of PCMT1 expression in NIH/3T3.)

Testing Data

(Detection limit for recombinant GST tagged PCMT1 is ~0.1ng/ml as a capture antibody.)

Related Product Information for anti-PCMT1 antibody

Three classes of protein carboxyl methyltransferases, distinguished by their methyl-acceptor substrate specificity, have been found in prokaryotic and eukaryotic cells. The type II enzyme catalyzes the transfer of a methyl group from S-adenosyl-L-methionine to the free carboxyl groups of D-aspartyl and L-isoaspartyl residues. These methyl-accepting residues result from the spontaneous deamidation, isomerization, and racemization of normal L-aspartyl and L-asparaginyl residues and represent sites of covalent damage to aging proteins PCMT1 (EC 2.1.1.77) is a protein repair enzyme that initiates the conversion of abnormal D-aspartyl and L-isoaspartyl residues to the normal L-aspartyl form. [supplied by OMIM]

Product Categories/Family for anti-PCMT1 antibody

Antibodies; Enzymes; Methyltransferase

NCBI and Uniprot Product Information

• NCBI GI #: 226530908
• NCBI GeneID: 5110
• NCBI Accession #: NP_005380
• NCBI GenBank Nucleotide #: NM_005389
• UniProt Accession #: P22061
• Molecular Weight: 25kDa
• NCBI Official Full Name: protein-L-isoaspartate(D-aspartate) O-methyltransferase isoform 1
• NCBI Official Synonym Full Names: protein-L-isoaspartate (D-aspartate) O-methyltransferase
• NCBI Official Symbol: PCMT1
• NCBI Official Synonym Symbols: PIMT
• NCBI Protein Information: protein-L-isoaspartate(D-aspartate) O-methyltransferase
• UniProt Protein Name: Protein-L-isoaspartate(D-aspartate) O-methyltransferase
• UniProt Gene Name: PCMT1
• UniProt Synonym Gene Names: PIMT
• UniProt Entry Name: PIMT_HUMAN

NCBI Description

This gene encodes a member of the type II class of protein carboxyl methyltransferase enzymes. The encoded enzyme plays a role in protein repair by recognizing and converting D-aspartyl and L-isoaspartyl residues resulting from spontaneous deamidation back to the normal L-aspartyl form. The encoded protein may play a protective role in the pathogenesis of Alzheimer's disease, and single nucleotide polymorphisms in this gene have been associated with spina bifida and premature ovarian failure. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Oct 2011]

Uniprot Description

PCMT1: Catalyzes the methyl esterification of L-isoaspartyl and D-aspartyl residues in peptides and proteins that result from spontaneous decomposition of normal L-aspartyl and L-asparaginyl residues. It plays a role in the repair and/or degradation of damaged proteins. Acts on microtubule-associated protein 2, calreticulin, clathrin light chains a and b, Ubiquitin carboxyl- terminal hydrolase isozyme L1, phosphatidylethanolamine-binding protein 1, stathmin, beta-synuclein and alpha-synuclein. Belongs to the methyltransferase superfamily. L- isoaspartyl/D-aspartyl protein methyltransferase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.1.1.77; Methyltransferase

Chromosomal Location of Human Ortholog: 6q25.1

Cellular Component: endoplasmic reticulum; cytoplasm; vesicle

Molecular Function: protein-L-isoaspartate (D-aspartate) O-methyltransferase activity

Biological Process: protein repair; protein amino acid methylation