Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CXCL9 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Liver)

Rabbit CXCL9 Polyclonal Antibody | anti-CXCL9 antibody

CXCL9 antibody - middle region

Gene Names
CXCL9; CMK; MIG; Humig; SCYB9; crg-10
Reactivity
Cow, Horse, Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CXCL9; Polyclonal Antibody; CXCL9 antibody - middle region; anti-CXCL9 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Horse, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQ
Sequence Length
125
Applicable Applications for anti-CXCL9 antibody
Western Blot (WB)
Homology
Cow: 90%; Horse: 100%; Human: 100%; Mouse: 83%; Pig: 91%; Rat: 83%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CXCL9
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CXCL9 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Liver)

Western Blot (WB) (WB Suggested Anti-CXCL9 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Liver)
Related Product Information for anti-CXCL9 antibody
This is a rabbit polyclonal antibody against CXCL9. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The function of CXCL9 has not been specifically defined; however, it is thought to be involved in T cell trafficking. This gene has been localized to 4q21 with INP10, which is also a member of the chemokine family of cytokines.The function of this gene has not been specifically defined; however, it is thought to be involved in T cell trafficking. This gene has been localized to 4q21 with INP10, which is also a member of the chemokine family of cytokines. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-CXCL9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12kDa
NCBI Official Full Name
C-X-C motif chemokine 9
NCBI Official Synonym Full Names
C-X-C motif chemokine ligand 9
NCBI Official Symbol
CXCL9
NCBI Official Synonym Symbols
CMK; MIG; Humig; SCYB9; crg-10
NCBI Protein Information
C-X-C motif chemokine 9
UniProt Protein Name
C-X-C motif chemokine 9
Protein Family
UniProt Gene Name
CXCL9
UniProt Synonym Gene Names
CMK; MIG; SCYB9; HuMIG; MIG
UniProt Entry Name
CXCL9_HUMAN

NCBI Description

This antimicrobial gene encodes a protein thought to be involved in T cell trafficking. The encoded protein binds to C-X-C motif chemokine 3 and is a chemoattractant for lymphocytes but not for neutrophils. [provided by RefSeq, Sep 2014]

Uniprot Description

CXCL9: Cytokine that affects the growth, movement, or activation state of cells that participate in immune and inflammatory response. Chemotactic for activated T-cells. Binds to CXCR3. Belongs to the intercrine alpha (chemokine CxC) family.

Protein type: Motility/polarity/chemotaxis; Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 4q21

Cellular Component: extracellular space; extracellular region; external side of plasma membrane

Molecular Function: protein binding; CXCR3 chemokine receptor binding; chemokine activity; cytokine activity

Biological Process: defense response; positive regulation of leukocyte chemotaxis; response to lipopolysaccharide; positive regulation of cAMP metabolic process; chemotaxis; signal transduction; positive regulation of myoblast differentiation; regulation of cell proliferation; G-protein coupled receptor protein signaling pathway; cell-cell signaling; cellular defense response; immune response; positive regulation of release of sequestered calcium ion into cytosol; inflammatory response; defense response to virus

Research Articles on CXCL9

Similar Products

Product Notes

The CXCL9 cxcl9 (Catalog #AAA3224410) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CXCL9 antibody - middle region reacts with Cow, Horse, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CXCL9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CXCL9 cxcl9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QTCLNPDSAD VKELIKKWEK QVSQKKKQKN GKKHQKKKVL KVRKSQRSRQ. It is sometimes possible for the material contained within the vial of "CXCL9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.