Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-CUX1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Thyroid Gland TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:600Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit CUX1 Polyclonal Antibody | anti-CUX1 antibody

CUX1 antibody - N-terminal region

Gene Names
CUX1; CDP; CUX; p75; CASP; CDP1; COY1; Clox; GDDI; p100; p110; p200; CUTL1; GOLIM6; CDP/Cut; Cux/CDP; Nbla10317
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CUX1; Polyclonal Antibody; CUX1 antibody - N-terminal region; anti-CUX1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VKNQEVTIKALKEKIREYEQTLKNQAETIALEKEQKLQNDFAEKERKLQE
Sequence Length
678
Applicable Applications for anti-CUX1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CUX1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-CUX1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Thyroid Gland TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:600Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (Rabbit Anti-CUX1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Thyroid Gland TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:600Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(Host: MouseTarget Name: CUX1Sample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: CUX1Sample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-CUX1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Spleen)

Western Blot (WB) (WB Suggested Anti-CUX1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Spleen)
Related Product Information for anti-CUX1 antibody
This is a rabbit polyclonal antibody against CUX1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The protein encoded by this gene is a member of the homeodomain family of DNA binding proteins. It may regulate gene expression, morphogenesis, and differentiation and it may also play a role in the cell cycle progession. Several alternatively spliced tra

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
77kDa
NCBI Official Full Name
protein CASP isoform b
NCBI Official Synonym Full Names
cut like homeobox 1
NCBI Official Symbol
CUX1
NCBI Official Synonym Symbols
CDP; CUX; p75; CASP; CDP1; COY1; Clox; GDDI; p100; p110; p200; CUTL1; GOLIM6; CDP/Cut; Cux/CDP; Nbla10317
NCBI Protein Information
protein CASP; Homeobox protein cut-like 1
UniProt Protein Name
Protein CASP
Protein Family
UniProt Gene Name
CUX1
UniProt Synonym Gene Names
CUTL1
UniProt Entry Name
CASP_HUMAN

NCBI Description

The protein encoded by this gene is a member of the homeodomain family of DNA binding proteins. It may regulate gene expression, morphogenesis, and differentiation and it may also play a role in the cell cycle progession. Several alternatively spliced transcript variants encoding different isoforms have been identified.[provided by RefSeq, Feb 2011]

Uniprot Description

CUTL1 iso1: Probably has a broad role in mammalian development as a repressor of developmentally regulated gene expression. May act by preventing binding of positively-activing CCAAT factors to promoters. Component of nf-munr repressor; binds to the matrix attachment regions (MARs) (5' and 3') of the immunoglobulin heavy chain enhancer. Represses T-cell receptor (TCR) beta enhancer function by binding to MARbeta, an ATC-rich DNA sequence located upstream of the TCR beta enhancer. Belongs to the CUT homeobox family. 8 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 7q22.1

Cellular Component: integral to Golgi membrane; cytosol; nucleus

Molecular Function: sequence-specific DNA binding; chromatin binding

Biological Process: regulation of transcription from RNA polymerase II promoter; intra-Golgi vesicle-mediated transport; transcription, DNA-dependent; multicellular organismal development; positive regulation of transcription from RNA polymerase II promoter; auditory receptor cell differentiation; negative regulation of transcription from RNA polymerase II promoter; positive regulation of dendrite morphogenesis; kidney development; lung development

Research Articles on CUX1

Similar Products

Product Notes

The CUX1 cux1 (Catalog #AAA3201882) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CUX1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CUX1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CUX1 cux1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VKNQEVTIKA LKEKIREYEQ TLKNQAETIA LEKEQKLQND FAEKERKLQE. It is sometimes possible for the material contained within the vial of "CUX1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.