Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CRY2Sample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human CRY2 Polyclonal Antibody | anti-CRY2 antibody

CRY2 Antibody - C-terminal region

Gene Names
CRY2; HCRY2; PHLL2
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CRY2; Polyclonal Antibody; CRY2 Antibody - C-terminal region; anti-CRY2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VPSCVEDLSHPVAEPSSSQAGSMSSAGPRPLPSGPASPKRKLEAAEEPPG
Sequence Length
532
Applicable Applications for anti-CRY2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human CRY2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CRY2Sample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CRY2Sample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-CRY2 antibody
This is a rabbit polyclonal antibody against CRY2. It was validated on Western Blot

Target Description: This gene encodes a flavin adenine dinucleotide-binding protein that is a key component of the circadian core oscillator complex, which regulates the circadian clock. This gene is upregulated by CLOCK/ARNTL heterodimers but then represses this upregulation in a feedback loop using PER/CRY heterodimers to interact with CLOCK/ARNTL. Polymorphisms in this gene have been associated with altered sleep patterns. The encoded protein is widely conserved across plants and animals. Two transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-CRY2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
58kDa
NCBI Official Full Name
Cryptochrome-2
NCBI Official Synonym Full Names
cryptochrome circadian regulator 2
NCBI Official Symbol
CRY2
NCBI Official Synonym Symbols
HCRY2; PHLL2
NCBI Protein Information
cryptochrome-2
UniProt Protein Name
Cryptochrome-2
Protein Family
UniProt Gene Name
CRY2
UniProt Synonym Gene Names
KIAA0658
UniProt Entry Name
CRY2_HUMAN

NCBI Description

This gene encodes a flavin adenine dinucleotide-binding protein that is a key component of the circadian core oscillator complex, which regulates the circadian clock. This gene is upregulated by CLOCK/ARNTL heterodimers but then represses this upregulation in a feedback loop using PER/CRY heterodimers to interact with CLOCK/ARNTL. Polymorphisms in this gene have been associated with altered sleep patterns. The encoded protein is widely conserved across plants and animals. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2014]

Uniprot Description

CRY2: Blue light-dependent regulator of the circadian feedback loop. Inhibits CLOCK|NPAS2-ARNTL E box-mediated transcription. Acts, in conjunction with CRY2, in maintaining period length and circadian rhythmicity. Has no photolyase activity. Capable of translocating circadian clock core proteins such as PER proteins to the nucleus. May inhibit CLOCK|NPAS2-ARNTL transcriptional activity through stabilizing the unphosphorylated form of ARNTL. Belongs to the DNA photolyase class-1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Lyase

Chromosomal Location of Human Ortholog: 11p11.2

Cellular Component: cytoplasm; extracellular region; nucleus

Molecular Function: ubiquitin binding; protein binding; DNA binding; DNA (6-4) photolyase activity; damaged DNA binding; deoxyribodipyrimidine photo-lyase activity; blue light photoreceptor activity; single-stranded DNA binding; phosphatase binding

Biological Process: circadian rhythm; photoreactive repair; transcription, DNA-dependent; negative regulation of transcription from RNA polymerase II promoter; glucose homeostasis; regulation of circadian rhythm; protein-chromophore linkage; entrainment of circadian clock by photoperiod; blue light signaling pathway; negative regulation of phosphoprotein phosphatase activity; negative regulation of circadian rhythm; circadian regulation of gene expression; negative regulation of transcription, DNA-dependent

Research Articles on CRY2

Similar Products

Product Notes

The CRY2 cry2 (Catalog #AAA3220211) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CRY2 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CRY2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CRY2 cry2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VPSCVEDLSH PVAEPSSSQA GSMSSAGPRP LPSGPASPKR KLEAAEEPPG. It is sometimes possible for the material contained within the vial of "CRY2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.