CRY2 Polyclonal Antibody | anti-CRY2 antibody

Anti-CRY2 Antibody

Cat. Num. AAA177875

• Gene Names: CRY2; HCRY2; PHLL2
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry
• Purity: Immunogen Affinity Purified
• Synonyms: CRY2; Polyclonal Antibody; Anti-CRY2 Antibody; Cryptochrome-2; cry2; CRY2_HUMAN; cryptochrome 2 (photolyase like); Cryptochrome 2; FLJ10332; growth inhibiting protein 37; HCRY2; KIAA0658; PHLL2; Photolyase like; cryptochrome circadian clock 2; anti-CRY2 antibody

• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 532

• Applicable Applications for anti-CRY2 antibody: Western Blot (WB), Immunohistochemistry (IHC) Paraffin
• Application Notes: Western Blot Concentration: 0.1-0.5ug/ml; Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human CRY2 (171-200aa RFQAIISRMELPKKPVGLVTSQQMESCRAE), different from the related mouse and rat sequences by five amino acids.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- CRY2 Picoband antibody, MBS177875, Western blottingAll lanes: Anti CRY2 (MBS177875) at 0.5ug/mlLane 1: Rat Testis Tissue Lysate at 50ugLane 2: Rat Brain Tissue Lysate at 50ugLane 3: Mouse Brain Tissue Lysate at 50ugLane 4: 22RV1 Whole Cell Lysate at 40ugPredicted bind size: 67KDObserved bind size: 67KD )

Immunohistochemistry (IHC)

(Anti- CRY2 Picoband antibody, MBS177875,IHC(P)IHC(P): Rat Liver Tissue )

Immunohistochemistry (IHC)

(Anti- CRY2 Picoband antibody, MBS177875,IHC(P)IHC(P): Mouse Kidney Tissue )

Related Product Information for anti-CRY2 antibody

Description: Rabbit IgG polyclonal antibody for Cryptochrome-2(CRY2) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: This gene encodes a flavin adenine dinucleotide-binding protein that is a key component of the circadian core oscillator complex, which regulates the circadian clock. And it is upregulated by CLOCK/ARNTL heterodimers but then represses this upregulation in a feedback loop using PER/CRY heterodimers to interact with CLOCK/ARNTL. Polymorphisms in this gene have been associated with altered sleep patterns. The encoded protein is widely conserved across plants and animals. Two transcript variants encoding different isoforms have been found for this gene.

References

1. Kovanen L, Kaunisto M, Donner K, Saarikoski ST, Partonen T. "CRY2 genetic variants associate with dysthymia." PLoS One, 2013. 2. Mao Y, Fu A, Hoffman AE, Jacobs DI, Jin M, Chen K, Zhu Y. "The circadian gene CRY2 is associated with breast cancer aggressiveness possibly via epigenomic modifications." Tumour Biol, 2015 May.

NCBI and Uniprot Product Information

• NCBI GI #: 188536103
• NCBI GeneID: 1408
• NCBI Accession #: NP_001120929.1
• NCBI GenBank Nucleotide #: NM_001127457.2
• UniProt Accession #: Q49AN0; O75148; Q8IV71; B4DH32; B4DZD6
• Molecular Weight: 60,593 Da
• NCBI Official Full Name: cryptochrome-2 isoform 2
• NCBI Official Synonym Full Names: cryptochrome circadian clock 2
• NCBI Official Symbol: CRY2
• NCBI Official Synonym Symbols: HCRY2; PHLL2
• NCBI Protein Information: cryptochrome-2
• UniProt Protein Name: Cryptochrome-2
• Protein Family: Cryptochrome
• UniProt Gene Name: CRY2
• UniProt Synonym Gene Names: KIAA0658
• UniProt Entry Name: CRY2_HUMAN

NCBI Description

This gene encodes a flavin adenine dinucleotide-binding protein that is a key component of the circadian core oscillator complex, which regulates the circadian clock. This gene is upregulated by CLOCK/ARNTL heterodimers but then represses this upregulation in a feedback loop using PER/CRY heterodimers to interact with CLOCK/ARNTL. Polymorphisms in this gene have been associated with altered sleep patterns. The encoded protein is widely conserved across plants and animals. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2014]

Uniprot Description

CRY2: Blue light-dependent regulator of the circadian feedback loop. Inhibits CLOCK|NPAS2-ARNTL E box-mediated transcription. Acts, in conjunction with CRY2, in maintaining period length and circadian rhythmicity. Has no photolyase activity. Capable of translocating circadian clock core proteins such as PER proteins to the nucleus. May inhibit CLOCK|NPAS2-ARNTL transcriptional activity through stabilizing the unphosphorylated form of ARNTL. Belongs to the DNA photolyase class-1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Lyase; DNA-binding

Chromosomal Location of Human Ortholog: 11p11.2

Cellular Component: cytoplasm; extracellular region; nucleus

Molecular Function: blue light photoreceptor activity; damaged DNA binding; deoxyribodipyrimidine photo-lyase activity; DNA (6-4) photolyase activity; DNA binding; phosphatase binding; protein binding; single-stranded DNA binding; ubiquitin binding

Biological Process: blue light signaling pathway; circadian regulation of gene expression; circadian rhythm; entrainment of circadian clock by photoperiod; glucose homeostasis; negative regulation of circadian rhythm; negative regulation of phosphoprotein phosphatase activity; negative regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; photoreactive repair; protein-chromophore linkage; regulation of circadian rhythm; transcription, DNA-dependent