Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-COL4A3BP Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysate)

Rabbit COL4A3BP Polyclonal Antibody | anti-COL4A3BP antibody

COL4A3BP antibody - N-terminal region

Gene Names
COL4A3BP; CERT; GPBP; CERTL; MRD34; STARD11
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
COL4A3BP; Polyclonal Antibody; COL4A3BP antibody - N-terminal region; anti-COL4A3BP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PPVERCGVLSKWTNYIHGWQDRWVVLKNNALSYYKSEDETEYGCRGSICL
Sequence Length
598
Applicable Applications for anti-COL4A3BP antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 92%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human COL4A3BP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-COL4A3BP Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysate)

Western Blot (WB) (WB Suggested Anti-COL4A3BP Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysate)
Related Product Information for anti-COL4A3BP antibody
This is a rabbit polyclonal antibody against COL4A3BP. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: COL4A3BP is a kinase that specifically phosphorylates the N-terminal region of the non-collagenous domain of the alpha 3 chain of type IV collagen, known as the Goodpasture antigen. Goodpasture disease is the result of an autoimmune response directed at this antigen. One isoform of this protein is also involved in ceramide intracellular transport.This gene encodes a kinase that specifically phosphorylates the N-terminal region of the non-collagenous domain of the alpha 3 chain of type IV collagen, known as the Goodpasture antigen. Goodpasture disease is the result of an autoimmune response directed at this antigen. One isoform of this protein is also involved in ceramide intracellular transport. Two transcripts exist for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
68kDa
NCBI Official Full Name
collagen type IV alpha-3-binding protein isoform 2
NCBI Official Synonym Full Names
collagen type IV alpha 3 binding protein
NCBI Official Symbol
COL4A3BP
NCBI Official Synonym Symbols
CERT; GPBP; CERTL; MRD34; STARD11
NCBI Protein Information
collagen type IV alpha-3-binding protein
UniProt Protein Name
Collagen type IV alpha-3-binding protein
UniProt Gene Name
COL4A3BP
UniProt Synonym Gene Names
CERT; STARD11; hCERT; GPBP; StARD11
UniProt Entry Name
C43BP_HUMAN

NCBI Description

This gene encodes a kinase that specifically phosphorylates the N-terminal region of the non-collagenous domain of the alpha 3 chain of type IV collagen, known as the Goodpasture antigen. Goodpasture disease is the result of an autoimmune response directed at this antigen. One isoform of this protein is also involved in ceramide intracellular transport. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

COL4A3BP: a protein with a lipid-binding domain that mediates intracellular trafficking of ceramide in a non-vesicular manner. Implicated in human autoimmune diseases via its association with the Goodpasture antigen. Phosphorylation on Ser-132 decreases the affinity toward phosphatidylinositol 4-phosphate at Golgi membranes and reduces ceramide transfer activity. GPBP has been reported to have Ser/Thr protein kinase activity towards the Goodpasture (GP) antigen, but lacks a conventional serine/threonine kinase domain. Two human isoforms of the human protein are produced by alternative splicing.

Protein type: Protein kinase, Ser/Thr (non-receptor); EC 2.7.11.9; Lipid-binding; Kinase, protein; Protein kinase, atypical; ATYPICAL group; COL4A3BP family

Chromosomal Location of Human Ortholog: 5q13.3

Cellular Component: nucleoplasm; Golgi apparatus; endoplasmic reticulum membrane; mitochondrion; perinuclear region of cytoplasm; cytosol

Molecular Function: protein binding; protein kinase activity

Biological Process: heart morphogenesis; endoplasmic reticulum organization and biogenesis; sphingolipid metabolic process; sphingolipid biosynthetic process; in utero embryonic development; cell morphogenesis; lipid homeostasis; signal transduction; protein amino acid phosphorylation; cell proliferation; muscle contraction; immune response; ceramide metabolic process

Disease: Mental Retardation, Autosomal Dominant 34

Research Articles on COL4A3BP

Similar Products

Product Notes

The COL4A3BP col4a3bp (Catalog #AAA3210780) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The COL4A3BP antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's COL4A3BP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the COL4A3BP col4a3bp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PPVERCGVLS KWTNYIHGWQ DRWVVLKNNA LSYYKSEDET EYGCRGSICL. It is sometimes possible for the material contained within the vial of "COL4A3BP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.