PRAME recombinant protein

Human PRAME

Cat. Num. AAA691844

• Gene Names: PRAME; MAPE; OIP4; CT130; OIP-4
• Reactivity: Human
• Applications: Western Blot, ELISA
• Purity: > 98% by SDS-PAGE & silver stain
• Synonyms: PRAME; Human PRAME; Recombinant Human PRAME (C-terminal fragment); Melanoma antigen preferentially expressed in tumors; Opa-interacting protein 4; MAPE; OIP4; PRAME recombinant protein

• Host: E Coli
• Reactivity: Human
• Purity/Purification: > 98% by SDS-PAGE & silver stain
• Form/Format: Lyophilized
• Sequence: MNPLETLSITNCRLSEGDVMHLSQSPSVSQLSVLSLSGVMLTDVSPEPLQ ALLERASATLQDLVFDECGITDDQLLALLPSLSHCSQLTTLSFYGNSISI
• Sequence Length: 100

• Applicable Applications for PRAME recombinant protein: Western Blot (WB), ELISA
• Application Notes: 1. Positive control for Western blot analysis; 2. Standard for ELISA.
• Stabilizer: none
• Buffer: 10mM Tris, 25 mM NaP, pH 7.4
• Length (aa): 100
• Preparation and Storage: Stability: The lyophilized human PRAME, though stable at room temperature, is best stored desiccated below 0°C. Reconstituted human PRAME should be stored in working aliquots at -20°C.; ; Reconstitution: Human PRAME should be reconstituted in water to a concentration of 0.1 mg/ml. This solution can be diluted in water or other buffer solutions or stored at -20°C.

Testing Data

Testing Data #2

Related Product Information for PRAME recombinant protein

PRAME/MAPE/OIP4 is a germinal tissue-specific gene that is also expressed at high levels in haematological malignancies and solid tumors. The physiological functions of PRAME in normal and tumor cells are unknown, although a role in the regulation of retinoic acid signaling has been proposed. Sequence homology and structural predictions suggest that PRAME is related to the Leucine-rich repeat (LRR) family of proteins, which have diverse functions. PRAME, or "žpreferentially expressed antigen in melanoma", was originally identified as a gene encoding a HLA-A24 restricted antigenic peptide presented to autologous tumor-specific cytotoxic T lymphocytes derived from a patient with melanoma. PRAME is synonymous with MAPE (melanoma antigen preferentially expressed in tumors) and OIP4 (OPA-interacting protein 4), and its expression profile defines it as a cancer-testis antigen. Cancer-testis antigens (CTAs) are encoded by non-mutated genes expressed at high levels in germinal tissues and tumors, but which are absent from or detected at low levels in other tissues. PRAME may be somewhat different to other cancer-testis antigens in that it shows some expression in normal tissues such as ovary, adrenal, placenta and endometrium. The C-terminus of human PRAME (amino acids 453-509) was also identified to bind Neisseria gonorrhoeae opacity factors, in this case the OPA-P protein. Thus PRAME is also known as OIP4 (OPA interacting protein), although the functional implications of the interaction are unknown.

Product Categories/Family for PRAME recombinant protein

Cytokines & Growth Factors

References

1. Ikeda H et al, Immunity 1997, 6:199-208 2. Haqq C et al, Proc Natl Acad Sci USA 2005, 102:6092 3. Williams JM et al, Mol Microbiol 1998, 27:171-186 4. Nakamura Y et al, Ann Surg Oncol 2007, 14:885-892

NCBI and Uniprot Product Information

• NCBI GI #: 5174641
• NCBI GeneID: 23532
• NCBI Accession #: NP_006106.1
• NCBI GenBank Nucleotide #: NM_006115.3
• UniProt Accession #: P78395; O43481; Q8IXN8; B2R6Y7
• Molecular Weight: 10.7 kDa
• NCBI Official Full Name: melanoma antigen preferentially expressed in tumors
• NCBI Official Synonym Full Names: preferentially expressed antigen in melanoma
• NCBI Official Symbol: PRAME
• NCBI Official Synonym Symbols: MAPE; OIP4; CT130; OIP-4
• NCBI Protein Information: melanoma antigen preferentially expressed in tumors; cancer/testis antigen 130; opa-interacting protein 4; Opa-interacting protein OIP4; preferentially expressed antigen of melanoma
• UniProt Protein Name: Melanoma antigen preferentially expressed in tumors
• Protein Family: PRAME family
• UniProt Gene Name: PRAME
• UniProt Synonym Gene Names: MAPE; OIP4; OIP-4
• UniProt Entry Name: PRAME_HUMAN

NCBI Description

This gene encodes an antigen that is predominantly expressed in human melanomas and that is recognized by cytolytic T lymphocytes. It is not expressed in normal tissues, except testis. This expression pattern is similar to that of other CT antigens, such as MAGE, BAGE and GAGE. However, unlike these other CT antigens, this gene is also expressed in acute leukemias. Five alternatively spliced transcript variants encoding the same protein have been observed for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: Functions as a transcriptional repressor, inhibiting the signaling of retinoic acid through the retinoic acid receptors RARA, RARB and RARG. Prevents retinoic acid-induced cell proliferation arrest, differentiation and apoptosis. Ref.7

Subunit structure: Interacts with RARA (via the ligand-binding domain); the interaction is direct and ligand (retinoic acid)-dependent. Interacts with EZH2; required to repress RAR signaling. Ref.7

Subcellular location: Nucleus

Probable. Cell membrane Ref.8.

Tissue specificity: Expressed in testis. Detected in samples of kidney, brain and skin. Ref.1

Miscellaneous: Tumor antigen recognized by cytolytic T lymphocytes.

Sequence similarities: Belongs to the PRAME family.Contains 4 LRR (leucine-rich) repeats.