Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: RQCD1Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/mlRQCD1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Rabbit CNOT9 Polyclonal Antibody | anti-CNOT9 antibody

CNOT9 Antibody - middle region

Gene Names
CNOT9; RCD1; CAF40; CT129; RCD-1; RQCD1
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CNOT9; Polyclonal Antibody; CNOT9 Antibody - middle region; anti-CNOT9 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SLGVIGALVKTDEQEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQK
Sequence Length
299
Applicable Applications for anti-CNOT9 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 79%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 86%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human RQCD1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: RQCD1Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/mlRQCD1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Western Blot (WB) (Host: RabbitTarget Name: RQCD1Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/mlRQCD1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)
Related Product Information for anti-CNOT9 antibody
This is a rabbit polyclonal antibody against RQCD1. It was validated on Western Blot

Target Description: This gene encodes a member of the highly conserved RCD1 protein family. The encoded protein is a transcriptional cofactor and a core protein of the CCR4-NOT complex. It may be involved in signal transduction as well as retinoic acid-regulated cell differentiation and development. Alternatively spliced transcript variants have been described for this gene.
Product Categories/Family for anti-CNOT9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
CCR4-NOT transcription complex subunit 9 isoform 2
NCBI Official Synonym Full Names
CCR4-NOT transcription complex subunit 9
NCBI Official Symbol
CNOT9
NCBI Official Synonym Symbols
RCD1; CAF40; CT129; RCD-1; RQCD1
NCBI Protein Information
CCR4-NOT transcription complex subunit 9
UniProt Protein Name
Cell differentiation protein RCD1 homolog
UniProt Gene Name
RQCD1
UniProt Synonym Gene Names
CNOT9; RCD1; Rcd-1
UniProt Entry Name
RCD1_HUMAN

NCBI Description

This gene encodes a member of the highly conserved RCD1 protein family. The encoded protein is a transcriptional cofactor and a core protein of the CCR4-NOT complex. It may be involved in signal transduction as well as retinoic acid-regulated cell differentiation and development. Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Oct 2012]

Uniprot Description

RQCD1: Transcription factor that down-regulates MYB- and JUN- dependent transcription. May play a role in cell differentiation. Can bind oligonucleotides, such as poly-G, poly-C or poly-T (in vitro), but the physiological relevance of this is not certain. Does not bind poly-A. Enhances ligand-dependent transcriptional activity of nuclear hormone receptors, including RARA, expect ESR1-mediated transcription that is not only slightly increased, if at all. Belongs to the RCD1 family.

Protein type: Cancer Testis Antigen (CTA)

Chromosomal Location of Human Ortholog: 2q35

Cellular Component: membrane; nucleus; cytosol; CCR4-NOT complex

Molecular Function: protein domain specific binding; protein binding; protein homodimerization activity

Biological Process: regulation of translation; poly(A) tail shortening; transcription, DNA-dependent; regulation of transcription, DNA-dependent; cytokine and chemokine mediated signaling pathway; gene expression; RNA-mediated gene silencing; sex differentiation; mRNA catabolic process, deadenylation-dependent decay; negative regulation of estrogen receptor signaling pathway

Research Articles on CNOT9

Similar Products

Product Notes

The CNOT9 rqcd1 (Catalog #AAA3217040) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CNOT9 Antibody - middle region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CNOT9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CNOT9 rqcd1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SLGVIGALVK TDEQEVINFL LTTEIIPLCL RIMESGSELS KTVATFILQK. It is sometimes possible for the material contained within the vial of "CNOT9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.