Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CLDN18Sample Type: JurkatLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5ug/mlLysate Quantity: 25ug/lane/laneGel Concentration: 0.12)

Rabbit CLDN18 Polyclonal Antibody | anti-CLDN18 antibody

CLDN18 antibody - C-terminal region

Gene Names
CLDN18; SFTA5; SFTPJ
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CLDN18; Polyclonal Antibody; CLDN18 antibody - C-terminal region; anti-CLDN18 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PEETNYKAVSYHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDE
Sequence Length
261
Applicable Applications for anti-CLDN18 antibody
Western Blot (WB)
Homology
Cow: 85%; Dog: 79%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CLDN18
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CLDN18Sample Type: JurkatLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5ug/mlLysate Quantity: 25ug/lane/laneGel Concentration: 0.12)

Western Blot (WB) (Host: RabbitTarget Name: CLDN18Sample Type: JurkatLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5ug/mlLysate Quantity: 25ug/lane/laneGel Concentration: 0.12)

Western Blot (WB)

(WB Suggested Anti-CLDN18 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-CLDN18 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)
Related Product Information for anti-CLDN18 antibody
This is a rabbit polyclonal antibody against CLDN18. It was validated on Western Blot

Target Description: CLDN18 belongs to the large claudin family of proteins, which form tight junction strands in epithelial cells.CLDN18 belongs to the large claudin family of proteins, which form tight junction strands in epithelial cells (Niimi et al., 2001).[supplied by OMIM].
Product Categories/Family for anti-CLDN18 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
claudin-18 isoform 2
NCBI Official Synonym Full Names
claudin 18
NCBI Official Symbol
CLDN18
NCBI Official Synonym Symbols
SFTA5; SFTPJ
NCBI Protein Information
claudin-18
UniProt Protein Name
Claudin-18
Protein Family
UniProt Gene Name
CLDN18
UniProt Entry Name
CLD18_HUMAN

NCBI Description

This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. This gene is upregulated in patients with ulcerative colitis and highly overexpressed in infiltrating ductal adenocarcinomas. PKC/MAPK/AP-1 (protein kinase C/mitogen-activated protein kinase/activator protein-1) dependent pathway regulates the expression of this gene in gastric cells. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jun 2010]

Uniprot Description

Claudin-18: a multi-pass membrane protein with calcium-independent cell-adhesion activity that plays a major role in the formation of tight junctions. Belongs to the claudin family. Two isoforms of the human protein are produced by alternative splicing. Isoform 2 is a specific cell lineage marker. Its expression in normal tissues is restricted to differentiated epithelial cells of the gastric mucosa; it is absent from the gastric stem cells. Isoform 2 is expressed in a significant proportion of primary gastric cancers and metastases, as well as in subtypes of pancreatic, esophageal, ovarian, and lung tumors.

Protein type: Cell adhesion; Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 3q22.3

Cellular Component: tight junction; integral to membrane; plasma membrane

Molecular Function: identical protein binding; structural molecule activity

Biological Process: intercellular junction assembly and maintenance; calcium-independent cell-cell adhesion

Research Articles on CLDN18

Similar Products

Product Notes

The CLDN18 cldn18 (Catalog #AAA3205841) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CLDN18 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CLDN18 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CLDN18 cldn18 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PEETNYKAVS YHASGHSVAY KPGGFKASTG FGSNTKNKKI YDGGARTEDE. It is sometimes possible for the material contained within the vial of "CLDN18, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.