Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit Claudin 15 Polyclonal Antibody | anti-CLDN15 antibody

Claudin 15 antibody

Applications
Western Blot
Purity
Total IgG Protein A purified
Synonyms
Claudin 15; Polyclonal Antibody; Claudin 15 antibody; Polyclonal Claudin 15; Anti-Claudin 15; Claudin -15; CLDN15; anti-CLDN15 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
Claudin 15 antibody was raised against the C terminal of CLDN15
Purity/Purification
Total IgG Protein A purified
Form/Format
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CLDN15 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
228
Applicable Applications for anti-CLDN15 antibody
Western Blot (WB)
Application Notes
WB: 5 ug/ml
Biological Significance
Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet.
Cross-Reactivity
Human
Immunogen
Claudin 15 antibody was raised using the C terminal of CLDN15 corresponding to a region with amino acids LCSACCCGSDEDPAASARRPYQAPVSVMPVATSDQEGDSSFGKYGRNAYV
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for anti-CLDN15 antibody
Rabbit polyclonal Claudin 15 antibody raised against the C terminal of CLDN15
Product Categories/Family for anti-CLDN15 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
24 kDa (MW of target protein)
NCBI Official Full Name
claudin-15
NCBI Official Synonym Full Names
claudin 15
NCBI Official Symbol
CLDN15
NCBI Protein Information
claudin-15
UniProt Protein Name
Claudin-15
Protein Family
UniProt Gene Name
CLDN15
UniProt Entry Name
CLD15_HUMAN

NCBI Description

This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jun 2010]

Uniprot Description

Claudin-15: Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium- independent cell-adhesion activity. Belongs to the claudin family.

Protein type: Membrane protein, multi-pass; Membrane protein, integral; Cell adhesion

Chromosomal Location of Human Ortholog: 7q11.22

Cellular Component: tight junction; integral to membrane; lateral plasma membrane

Molecular Function: identical protein binding; structural molecule activity

Biological Process: intercellular junction assembly and maintenance; ion transport; calcium-independent cell-cell adhesion

Similar Products

Product Notes

The CLDN15 cldn15 (Catalog #AAA5302702) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Claudin 15 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 5 ug/ml. Researchers should empirically determine the suitability of the CLDN15 cldn15 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Claudin 15, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.