Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Claudin 16 antibody (MBS5300432) used at 0.5 ug/ml to detect target protein.)

Rabbit Claudin 16 Polyclonal Antibody | anti-CLDN16 antibody

Claudin 16 antibody

Gene Names
CLDN16; HOMG3; PCLN1
Applications
Western Blot
Purity
Affinity purified
Synonyms
Claudin 16; Polyclonal Antibody; Claudin 16 antibody; Polyclonal Claudin 16; Anti-Claudin 16; Claudin -16; HOMG3; CLDN16; PCLN1; anti-CLDN16 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
Claudin 16 antibody was raised against the C terminal of CLDN16
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CLDN16 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
305
Applicable Applications for anti-CLDN16 antibody
Western Blot (WB)
Application Notes
WB: 0.5 ug/ml
Biological Significance
Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. Claudin-16, a member of the claudin family, is an integral membrane protein and a component of tight junction strands.
Cross-Reactivity
Human
Immunogen
Claudin 16 antibody was raised using the C terminal of CLDN16 corresponding to a region with amino acids FLAGAVLTCCLYLFKDVGPERNYPYSLRKAYSAAGVSMAKSYSAPRTETA
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(Claudin 16 antibody (MBS5300432) used at 0.5 ug/ml to detect target protein.)

Western Blot (WB) (Claudin 16 antibody (MBS5300432) used at 0.5 ug/ml to detect target protein.)
Related Product Information for anti-CLDN16 antibody
Rabbit polyclonal Claudin 16 antibody raised against the C terminal of CLDN16
Product Categories/Family for anti-CLDN16 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
34 kDa (MW of target protein)
NCBI Official Full Name
claudin-16
NCBI Official Synonym Full Names
claudin 16
NCBI Official Symbol
CLDN16
NCBI Official Synonym Symbols
HOMG3; PCLN1
NCBI Protein Information
claudin-16
UniProt Protein Name
Claudin-16
Protein Family
UniProt Gene Name
CLDN16
UniProt Synonym Gene Names
PCLN1; PCLN-1
UniProt Entry Name
CLD16_HUMAN

NCBI Description

Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. The protein encoded by this gene, a member of the claudin family, is an integral membrane protein and a component of tight junction strands. It is found primarily in the kidneys, specifically in the thick ascending limb of Henle, where it acts as either an intercellular pore or ion concentration sensor to regulate the paracellular resorption of magnesium ions. Defects in this gene are a cause of primary hypomagnesemia, which is characterized by massive renal magnesium wasting with hypomagnesemia and hypercalciuria, resulting in nephrocalcinosis and renal failure. This gene and the CLDN1 gene are clustered on chromosome 3q28. [provided by RefSeq, Jun 2010]

Uniprot Description

Claudin-16: Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium- independent cell-adhesion activity. Involved in paracellular magnesium reabsorption. Required for a selective paracellular conductance. May form, alone or in partnership with other constituents, an intercellular pore permitting paracellular passage of magnesium and calcium ions down their electrochemical gradients. Alternatively, it could be a sensor of magnesium concentration that could alter paracellular permeability mediated by other factors. Defects in CLDN16 are the cause of hypomagnesemia type 3 (HOMG3); also known as familial hypomagnesemia with hypercalciuria and nephrocalcinosis (FHHNC). HOMG3 is a progressive renal disease characterized by primary renal magnesium wasting with hypomagnesemia, hypercalciuria and nephrocalcinosis. Recurrent urinary tract infections and kidney stones are often observed. In spite of hypercalciuria, patients do not show hypocalcemia. Belongs to the claudin family.

Protein type: Membrane protein, multi-pass; Cell adhesion; Membrane protein, integral

Chromosomal Location of Human Ortholog: 3q28

Cellular Component: tight junction; plasma membrane; integral to membrane

Molecular Function: identical protein binding; protein binding; magnesium ion transmembrane transporter activity; structural molecule activity

Biological Process: cellular metal ion homeostasis; excretion; calcium-independent cell-cell adhesion; magnesium ion transport

Disease: Hypomagnesemia 3, Renal

Research Articles on CLDN16

Similar Products

Product Notes

The CLDN16 cldn16 (Catalog #AAA5300432) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Claudin 16 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 0.5 ug/ml. Researchers should empirically determine the suitability of the CLDN16 cldn16 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Claudin 16, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.