Rabbit anti-Human CKMM Polyclonal Antibody | anti-CKMM antibody

CKMM (Creatine Kinase M-type, Creatine Kinase M Chain, M-CK, CKM, CK-MM) APC

Cat. Num. AAA6374028

• Gene Names: CKM; CKMM; M-CK
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CKMM; Polyclonal Antibody; CKMM (Creatine Kinase M-type; Creatine Kinase M Chain; M-CK; CKM; CK-MM) APC; anti-CKMM antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human CKM.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-CKMM antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human CKM, aa1-381 (AAH07462.1).
• Immunogen Sequence: MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSLLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK
• Conjugate: APC
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(CKM rabbit polyclonal antibody. Western Blot analysis of CKM expression in HepG2.)

Western Blot (WB)

(Western Blot analysis of CKM expression in transfected 293T cell line by CKM polyclonal antibody. Lane 1: CKM transfected lysate (43.1kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-CKMM antibody

The three isoenzymes (MM, MB, and BB) are found in muscle, cardiac and brain tissues. Creatine Kinases can be used for indications in many neuromuscular applications. These disorders include cardiac disease, mitochondrial disorders, inflammatory myopathies, myasthenia, polymyositis, McArdle's disease, NMJ disorders, muscular dystrophy, ALS, hypo and hyperthyroid disorders, central core disease, acid maltase deficiency, myoglobinuria, rhabdomyolysis, motor neuron diseases, rheumatic diseases, and other that create elevated or reduced levels of Creatine Kinases.

Product Categories/Family for anti-CKMM antibody

Antibodies; Enzymes; Creatine Kinase

NCBI and Uniprot Product Information

• NCBI GI #: 13938618
• NCBI GeneID: 1158
• Molecular Weight: 43,101 Da
• NCBI Official Full Name: Homo sapiens creatine kinase, muscle, mRNA
• NCBI Official Synonym Full Names: creatine kinase, M-type
• NCBI Official Symbol: CKM
• NCBI Official Synonym Symbols: CKMM; M-CK
• NCBI Protein Information: creatine kinase M-type

NCBI Description

The protein encoded by this gene is a cytoplasmic enzyme involved in energy homeostasis and is an important serum marker for myocardial infarction. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in striated muscle as well as in other tissues, and as a heterodimer with a similar brain isozyme in heart. The encoded protein is a member of the ATP:guanido phosphotransferase protein family. [provided by RefSeq, Jul 2008]