Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (CKM rabbit polyclonal antibody. Western Blot analysis of CKM expression in HepG2.)

Rabbit anti-Human CKMM Polyclonal Antibody | anti-CKMM antibody

CKMM (Creatine Kinase M-type, Creatine Kinase M Chain, M-CK, CKM, CK-MM) (Biotin)

Gene Names
CKM; CKMM; M-CK
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CKMM; Polyclonal Antibody; CKMM (Creatine Kinase M-type; Creatine Kinase M Chain; M-CK; CKM; CK-MM) (Biotin); anti-CKMM antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CKM.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-CKMM antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human CKM, aa1-381 (AAH07462.1).
Immunogen Sequence
MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSLLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(CKM rabbit polyclonal antibody. Western Blot analysis of CKM expression in HepG2.)

Western Blot (WB) (CKM rabbit polyclonal antibody. Western Blot analysis of CKM expression in HepG2.)

Western Blot (WB)

(Western Blot analysis of CKM expression in transfected 293T cell line by CKM polyclonal antibody. Lane 1: CKM transfected lysate (43.1kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CKM expression in transfected 293T cell line by CKM polyclonal antibody. Lane 1: CKM transfected lysate (43.1kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-CKMM antibody
The three isoenzymes (MM, MB, and BB) are found in muscle, cardiac and brain tissues. Creatine Kinases can be used for indications in many neuromuscular applications. These disorders include cardiac disease, mitochondrial disorders, inflammatory myopathies, myasthenia, polymyositis, McArdle's disease, NMJ disorders, muscular dystrophy, ALS, hypo and hyperthyroid disorders, central core disease, acid maltase deficiency, myoglobinuria, rhabdomyolysis, motor neuron diseases, rheumatic diseases, and other that create elevated or reduced levels of Creatine Kinases.
Product Categories/Family for anti-CKMM antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
43,101 Da
NCBI Official Full Name
Homo sapiens creatine kinase, muscle, mRNA
NCBI Official Synonym Full Names
creatine kinase, M-type
NCBI Official Symbol
CKM
NCBI Official Synonym Symbols
CKMM; M-CK
NCBI Protein Information
creatine kinase M-type

NCBI Description

The protein encoded by this gene is a cytoplasmic enzyme involved in energy homeostasis and is an important serum marker for myocardial infarction. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in striated muscle as well as in other tissues, and as a heterodimer with a similar brain isozyme in heart. The encoded protein is a member of the ATP:guanido phosphotransferase protein family. [provided by RefSeq, Jul 2008]

Research Articles on CKMM

Similar Products

Product Notes

The CKMM (Catalog #AAA6374029) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CKMM (Creatine Kinase M-type, Creatine Kinase M Chain, M-CK, CKM, CK-MM) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CKMM can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CKMM for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CKMM, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.