Mouse anti-Human CKMM Monoclonal Antibody | anti-CKMM antibody

CKMM (Creatine Kinase M-type, Creatine Kinase M Chain, M-CK, CKM, CK-MM) (HRP)

Cat. Num. AAA6151827

• Gene Names: CKM; CKMM; M-CK; CPK-M
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CKMM; Monoclonal Antibody; CKMM (Creatine Kinase M-type; Creatine Kinase M Chain; M-CK; CKM; CK-MM) (HRP); anti-CKMM antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1E3
• Specificity: Recognizes human CKMM.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-CKMM antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant protein corresponding to aa282-381 from human CKMM with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: TCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against immunogen using 125020 (36.74kD).)

Western Blot (WB)

(Western Blot analysis of CKMM expression in IMR-32 using 125020.)

Testing Data

(Detection limit is 0.03ng/ml using 125020 as a capture antibody.)

Related Product Information for anti-CKMM antibody

The three isoenzymes (MM, MB, and BB) are found in muscle, cardiac and brain tissues. Creatine Kinases can be used for indications in many neuromuscular applications. These disorders include cardiac disease, mitochondrial disorders, inflammatory myopathies, myasthenia, polymyositis, McArdle's disease, NMJ disorders, muscular dystrophy, ALS, hypo and hyperthyroid disorders, central core disease, acid maltase deficiency, myoglobinuria, rhabdomyolysis, motor neuron diseases, rheumatic diseases, and other that create elevated or reduced levels of Creatine Kinases.

Product Categories/Family for anti-CKMM antibody

Antibodies; Enzymes; Creatine Kinase

NCBI and Uniprot Product Information

• NCBI GI #: 21536288
• NCBI GeneID: 1158
• NCBI Accession #: NP_001815
• NCBI GenBank Nucleotide #: NM_001824
• UniProt Accession #: P06732
• Molecular Weight: 43kDa
• NCBI Official Full Name: creatine kinase M-type
• NCBI Official Synonym Full Names: creatine kinase, M-type
• NCBI Official Symbol: CKM
• NCBI Official Synonym Symbols: CKMM; M-CK; CPK-M
• NCBI Protein Information: creatine kinase M-type
• UniProt Protein Name: Creatine kinase M-type
• UniProt Gene Name: CKM
• UniProt Synonym Gene Names: CKMM
• UniProt Entry Name: KCRM_HUMAN

NCBI Description

The protein encoded by this gene is a cytoplasmic enzyme involved in energy homeostasis and is an important serum marker for myocardial infarction. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in striated muscle as well as in other tissues, and as a heterodimer with a similar brain isozyme in heart. The encoded protein is a member of the ATP:guanido phosphotransferase protein family. [provided by RefSeq, Jul 2008]

Uniprot Description

CKM: Reversibly catalyzes the transfer of phosphate between ATP and various phosphogens (e.g. creatine phosphate). Creatine kinase isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa. Belongs to the ATP:guanido phosphotransferase family.

Protein type: EC 2.7.3.2; Kinase, other; Amino Acid Metabolism - arginine and proline

Chromosomal Location of Human Ortholog: 19q13.32

Cellular Component: cytosol

Molecular Function: creatine kinase activity; ATP binding

Biological Process: phosphocreatine biosynthetic process; phosphorylation; creatine metabolic process