Western Blot (WB)
(WB Suggested Anti-C2TA Antibody Titration: 0.125ug/mlELISA Titer: 1:62500Positive Control: NIH/3T3 cell lysate)
Rabbit CIITA Polyclonal Antibody | anti-CIITA antibody
CIITA Antibody - C-terminal region
Gene Names
Ciita; C2ta; Gm9475; Mhc2ta; EG669998
Reactivity
Dog, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CIITA; Polyclonal Antibody; CIITA Antibody - C-terminal region; anti-CIITA antibody
Host
Rabbit
Reactivity
Dog, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MALWESLQQQGEAQLLQAAEEKFTIEPFKAKSPKDVEDLDRLVQTQRLRN
Sequence Length
1078
Applicable Applications for anti-CIITA antibody
Western Blot (WB)
Homology
Dog: 100%; Human: 79%; Mouse: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of mouse C2TA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-C2TA Antibody Titration: 0.125ug/mlELISA Titer: 1:62500Positive Control: NIH/3T3 cell lysate)
Western Blot (WB)
(WB Suggested Anti-C2TA Antibody Titration: 0.125ug/mlELISA Titer: 1:62500Positive Control: NIH/3T3 cell lysate)
Related Product Information for anti-CIITA antibody
This is a rabbit polyclonal antibody against C2TA. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: This gene encodes a member of the NOD-like receptor protein family. This protein acts as a transcriptional coactivator and component of the enhanceosome complex to stimulate transcription of MHC class II genes in the adaptive immune response. This protein may also regulate the transcription of MHC class I genes. Mutations in the human gene have been linked to a rare immunodeficiency, bare lymphocyte syndrome, and homozygous knockout mice exhibit many features of this disease. Alternative splicing results in multiple transcript variants encoding different isoforms.
Target Description: This gene encodes a member of the NOD-like receptor protein family. This protein acts as a transcriptional coactivator and component of the enhanceosome complex to stimulate transcription of MHC class II genes in the adaptive immune response. This protein may also regulate the transcription of MHC class I genes. Mutations in the human gene have been linked to a rare immunodeficiency, bare lymphocyte syndrome, and homozygous knockout mice exhibit many features of this disease. Alternative splicing results in multiple transcript variants encoding different isoforms.
Product Categories/Family for anti-CIITA antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
119kDa
NCBI Official Full Name
MHC class II transactivator isoform 2
NCBI Official Synonym Full Names
class II transactivator
NCBI Official Symbol
Ciita
NCBI Official Synonym Symbols
C2ta; Gm9475; Mhc2ta; EG669998
NCBI Protein Information
MHC class II transactivator
Protein Family
NCBI Description
This gene encodes a member of the NOD-like receptor protein family. This protein acts as a transcriptional coactivator and component of the enhanceosome complex to stimulate transcription of MHC class II genes in the adaptive immune response. This protein may also regulate the transcription of MHC class I genes. Mutations in the human gene have been linked to a rare immunodeficiency, bare lymphocyte syndrome, and homozygous knockout mice exhibit many features of this disease. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Oct 2014]
Research Articles on CIITA
Similar Products
Product Notes
The CIITA (Catalog #AAA3203322) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CIITA Antibody - C-terminal region reacts with Dog, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CIITA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CIITA for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MALWESLQQQ GEAQLLQAAE EKFTIEPFKA KSPKDVEDLD RLVQTQRLRN. It is sometimes possible for the material contained within the vial of "CIITA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
