Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CHRNB3 Antibody Titration: 0.03ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)

Rabbit CHRNB3 Polyclonal Antibody | anti-CHRNB3 antibody

CHRNB3 antibody - middle region

Reactivity
Cow, Dog, Guinea Pig, Horse, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CHRNB3; Polyclonal Antibody; CHRNB3 antibody - middle region; anti-CHRNB3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YDGTMVDLILINENVDRKDFFDNGEWEILNAKGMKGNRRDGVYSYPFITY
Sequence Length
458
Applicable Applications for anti-CHRNB3 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CHRNB3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CHRNB3 Antibody Titration: 0.03ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-CHRNB3 Antibody Titration: 0.03ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)
Related Product Information for anti-CHRNB3 antibody
This is a rabbit polyclonal antibody against CHRNB3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Nicotinic acetylcholine receptors (nAChRs) are ligand-gated ion channels nAChRs are pentameric structures that are made up of combinations of individual subunits. CHRNB3 is one of the subunits of nAChR. Twelve neuronal nAChR subunits have been described, alpha2-alpha10 and beta2-beta4. CHRNB3 decreased the channel mean open time and burst length. There was also an increase in single channel slope conductance. On the other hand, the calcium permeability and the pharmacological properties of beta3-containing receptors differed little from those of without beta3. Dysfunction of nAChR has been linked to a number of human diseases such as schizophrenia, Alzheimer's and Parkinson's diseases. nAChRs also play a significant role in nicotine addiction.
Product Categories/Family for anti-CHRNB3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53kDa
NCBI Official Full Name
neuronal acetylcholine receptor subunit beta-3 isoform 1
NCBI Official Synonym Full Names
cholinergic receptor nicotinic beta 3 subunit
NCBI Official Symbol
CHRNB3
NCBI Protein Information
neuronal acetylcholine receptor subunit beta-3
UniProt Protein Name
Neuronal acetylcholine receptor subunit beta-3
UniProt Gene Name
CHRNB3

NCBI Description

The nicotinic acetylcholine receptors (nAChRs) are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The nAChRs are (hetero)pentamers composed of homologous subunits. The subunits that make up the muscle and neuronal forms of nAChRs are encoded by separate genes and have different primary structure. There are several subtypes of neuronal nAChRs that vary based on which homologous subunits are arranged around the central channel. They are classified as alpha-subunits if, like muscle alpha-1 (MIM 100690), they have a pair of adjacent cysteines as part of the presumed acetylcholine binding site. Subunits lacking these cysteine residues are classified as beta-subunits (Groot Kormelink and Luyten, 1997 [PubMed 9009220]). Elliott et al. (1996) [PubMed 8906617] stated that the proposed structure for each subunit is a conserved N-terminal extracellular domain followed by 3 conserved transmembrane domains, a variable cytoplasmic loop, a fourth conserved transmembrane domain, and a short C-terminal extracellular region.[supplied by OMIM, Apr 2010]

Uniprot Description

After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.

Research Articles on CHRNB3

Similar Products

Product Notes

The CHRNB3 chrnb3 (Catalog #AAA3224477) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CHRNB3 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CHRNB3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CHRNB3 chrnb3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YDGTMVDLIL INENVDRKDF FDNGEWEILN AKGMKGNRRD GVYSYPFITY. It is sometimes possible for the material contained within the vial of "CHRNB3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.