Mouse anti-Human CHRNB3 Monoclonal Antibody | anti-CHRNB3 antibody

CHRNB3 (Neuronal Acetylcholine Receptor Subunit beta-3) (AP)

Cat. Num. AAA6130589

• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CHRNB3; Monoclonal Antibody; CHRNB3 (Neuronal Acetylcholine Receptor Subunit beta-3) (AP); anti-CHRNB3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 3G6
• Specificity: Recognizes human CHRNB3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-CHRNB3 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa128-223 from human CHRNB3 (NP_000740) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SLMTKVIVKSNGTVVWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSWTYDGTMVDLILINENVDRKDFFDNGEWEILNAKGMKGNRRDGVYSYPFI
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.3kD).)

Related Product Information for anti-CHRNB3 antibody

Neuronal acetylcholine receptors are homo- or heteropentameric complexes composed of homologous alpha and beta subunits. They belong to a superfamily of ligand-gated ion channels which allow the flow of sodium and potassium across the plasma membrane in response to ligands such as acetylcholine and nicotine. This gene encodes one of several beta subunits. Mutations in this gene are associated with autosomal dominant nocturnal frontal lobe epilepsy.

Product Categories/Family for anti-CHRNB3 antibody

Antibodies; Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 4502835
• NCBI GeneID: 1142
• NCBI Accession #: NP_000740
• NCBI GenBank Nucleotide #: NM_000749
• UniProt Accession #: Q05901
• Molecular Weight: 50kDa
• NCBI Official Full Name: neuronal acetylcholine receptor subunit beta-3 isoform 1
• NCBI Official Synonym Full Names: cholinergic receptor nicotinic beta 3 subunit
• NCBI Official Symbol: CHRNB3
• NCBI Protein Information: neuronal acetylcholine receptor subunit beta-3
• UniProt Protein Name: Neuronal acetylcholine receptor subunit beta-3
• Protein Family: Neuronal acetylcholine receptor
• UniProt Gene Name: CHRNB3

NCBI Description

The nicotinic acetylcholine receptors (nAChRs) are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The nAChRs are (hetero)pentamers composed of homologous subunits. The subunits that make up the muscle and neuronal forms of nAChRs are encoded by separate genes and have different primary structure. There are several subtypes of neuronal nAChRs that vary based on which homologous subunits are arranged around the central channel. They are classified as alpha-subunits if, like muscle alpha-1 (MIM 100690), they have a pair of adjacent cysteines as part of the presumed acetylcholine binding site. Subunits lacking these cysteine residues are classified as beta-subunits (Groot Kormelink and Luyten, 1997 [PubMed 9009220]). Elliott et al. (1996) [PubMed 8906617] stated that the proposed structure for each subunit is a conserved N-terminal extracellular domain followed by 3 conserved transmembrane domains, a variable cytoplasmic loop, a fourth conserved transmembrane domain, and a short C-terminal extracellular region.[supplied by OMIM, Apr 2010]

Uniprot Description

After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.