Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CHRNA5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Spleen)

Rabbit CHRNA5 Polyclonal Antibody | anti-CHRNA5 antibody

CHRNA5 antibody - middle region

Gene Names
CHRNA5; LNCR2
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CHRNA5; Polyclonal Antibody; CHRNA5 antibody - middle region; anti-CHRNA5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PDIVLFDNADGRFEGTSTKTVIRYNGTVTWTPPANYKSSCTIDVTFFPFD
Sequence Length
468
Applicable Applications for anti-CHRNA5 antibody
Western Blot (WB)
Homology
Cow: 85%; Dog: 79%; Horse: 85%; Human: 100%; Mouse: 92%; Pig: 85%; Rabbit: 92%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CHRNA5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CHRNA5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Spleen)

Western Blot (WB) (WB Suggested Anti-CHRNA5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Spleen)
Related Product Information for anti-CHRNA5 antibody
This is a rabbit polyclonal antibody against CHRNA5. It was validated on Western Blot

Target Description: Nicotinic acetylcholine receptors (nAChRs), such as CHRNA5, are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The nAChRs are thought to be (hetero)pentamers composed of homologous subunits.
Product Categories/Family for anti-CHRNA5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53kDa
NCBI Official Full Name
neuronal acetylcholine receptor subunit alpha-5 isoform 1
NCBI Official Synonym Full Names
cholinergic receptor nicotinic alpha 5 subunit
NCBI Official Symbol
CHRNA5
NCBI Official Synonym Symbols
LNCR2
NCBI Protein Information
neuronal acetylcholine receptor subunit alpha-5
UniProt Protein Name
Neuronal acetylcholine receptor subunit alpha-5
UniProt Gene Name
CHRNA5
UniProt Synonym Gene Names
NACHRA5
UniProt Entry Name
ACHA5_HUMAN

NCBI Description

The protein encoded by this gene is a nicotinic acetylcholine receptor subunit and a member of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. These receptors are thought to be heteropentamers composed of separate but similar subunits. Defects in this gene have been linked to susceptibility to lung cancer type 2 (LNCR2).[provided by RefSeq, Jun 2010]

Uniprot Description

nAChRA5: After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. Belongs to the ligand-gated ion channel (TC 1.A.9) family. Acetylcholine receptor (TC 1.A.9.1) subfamily. Alpha- 5/CHRNA5 sub-subfamily.

Protein type: Membrane protein, multi-pass; Channel, ligand-gated; Membrane protein, integral

Chromosomal Location of Human Ortholog: 15q24

Cellular Component: nicotinic acetylcholine-gated receptor-channel complex; postsynaptic membrane; plasma membrane; cell junction

Molecular Function: acetylcholine receptor activity; nicotinic acetylcholine-activated cation-selective channel activity; ligand-gated ion channel activity

Biological Process: synaptic transmission; transport; behavioral response to nicotine; signal transduction; cation transport

Disease: Smoking As A Quantitative Trait Locus 3

Research Articles on CHRNA5

Similar Products

Product Notes

The CHRNA5 chrna5 (Catalog #AAA3202378) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CHRNA5 antibody - middle region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CHRNA5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CHRNA5 chrna5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PDIVLFDNAD GRFEGTSTKT VIRYNGTVTW TPPANYKSSC TIDVTFFPFD. It is sometimes possible for the material contained within the vial of "CHRNA5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.