Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CHRNA4 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

Rabbit CHRNA4 Polyclonal Antibody | anti-CHRNA4 antibody

CHRNA4 antibody - N-terminal region

Gene Names
CHRNA4; EBN; BFNC; EBN1; NACHR; NACRA4; NACHRA4
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CHRNA4; Polyclonal Antibody; CHRNA4 antibody - N-terminal region; anti-CHRNA4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AEERLLKKLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTT
Sequence Length
627
Applicable Applications for anti-CHRNA4 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 93%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CHRNA4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CHRNA4 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-CHRNA4 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-CHRNA4 antibody
This is a rabbit polyclonal antibody against CHRNA4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: CHRNA4 is a nicotinic acetylcholine receptor, which belongs to a superfamily of ligand-gated ion channels that play a role in fast signal transmission at synapses. These pentameric receptors can bind acetylcholine, which causes an extensive change in conformation that leads to the opening of an ion-conducting channel across the plasma membrane. This protein is an integral membrane receptor subunit that can interact with either nAChR beta-2 or nAChR beta-4 to form a functional receptor. Mutations in this gene cause nocturnal frontal lobe epilepsy type 1. Polymorphisms in this gene that provide protection against nicotine addiction have been described. This gene encodes a nicotinic acetylcholine receptor, which belongs to a superfamily of ligand-gated ion channels that play a role in fast signal transmission at synapses. These pentameric receptors can bind acetylcholine, which causes an extensive change in conformation that leads to the opening of an ion-conducting channel across the plasma membrane. This protein is an integral membrane receptor subunit that can interact with either nAChR beta-2 or nAChR beta-4 to form a functional receptor. Mutations in this gene cause nocturnal frontal lobe epilepsy type 1. Polymorphisms in this gene that provide protection against nicotine addiction have been described. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
67kDa
NCBI Official Full Name
neuronal acetylcholine receptor subunit alpha-4 isoform 1
NCBI Official Synonym Full Names
cholinergic receptor nicotinic alpha 4 subunit
NCBI Official Symbol
CHRNA4
NCBI Official Synonym Symbols
EBN; BFNC; EBN1; NACHR; NACRA4; NACHRA4
NCBI Protein Information
neuronal acetylcholine receptor subunit alpha-4
UniProt Protein Name
Neuronal acetylcholine receptor subunit alpha-4
UniProt Gene Name
CHRNA4
UniProt Synonym Gene Names
NACRA4
UniProt Entry Name
ACHA4_HUMAN

NCBI Description

This gene encodes a nicotinic acetylcholine receptor, which belongs to a superfamily of ligand-gated ion channels that play a role in fast signal transmission at synapses. These pentameric receptors can bind acetylcholine, which causes an extensive change in conformation that leads to the opening of an ion-conducting channel across the plasma membrane. This protein is an integral membrane receptor subunit that can interact with either nAChR beta-2 or nAChR beta-4 to form a functional receptor. Mutations in this gene cause nocturnal frontal lobe epilepsy type 1. Polymorphisms in this gene that provide protection against nicotine addiction have been described. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2012]

Uniprot Description

nAChRA4: a ligand-gated ion channels that binds acetylcholine and mediates fast signal transmission at synapses. After binding acetylcholine, these pentameric receptors undergo an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. An integral membrane receptor subunit that can interact with either nAChR beta-2 or nAChR beta-4 to form a functional receptor.

Protein type: Membrane protein, multi-pass; Membrane protein, integral; Channel, ligand-gated; Receptor, misc.

Chromosomal Location of Human Ortholog: 20q13.33

Cellular Component: nicotinic acetylcholine-gated receptor-channel complex; postsynaptic membrane; cell soma; membrane; dendrite; integral to membrane; plasma membrane; cell junction; external side of plasma membrane

Molecular Function: acetylcholine receptor activity; acetylcholine binding; nicotinic acetylcholine-activated cation-selective channel activity; ligand-gated ion channel activity

Biological Process: response to nicotine; regulation of action potential; B cell activation; behavioral response to nicotine; locomotory behavior; respiratory gaseous exchange; signal transduction; DNA repair; sensory perception of pain; regulation of dopamine secretion; synaptic transmission, cholinergic; neurological system process; regulation of inhibitory postsynaptic membrane potential; synaptic transmission; membrane depolarization; regulation of membrane potential; calcium ion transport; response to hypoxia; ion transport; response to oxidative stress; cognition

Disease: Epilepsy, Nocturnal Frontal Lobe, 1; Tobacco Addiction, Susceptibility To

Research Articles on CHRNA4

Similar Products

Product Notes

The CHRNA4 chrna4 (Catalog #AAA3202377) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CHRNA4 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CHRNA4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CHRNA4 chrna4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AEERLLKKLF SGYNKWSRPV ANISDVVLVR FGLSIAQLID VDEKNQMMTT. It is sometimes possible for the material contained within the vial of "CHRNA4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.