Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CHRNA7Sample Type: Liver Tumor lysatesAntibody Dilution: 1.0ug/ml)

Rabbit CHRNA7 Polyclonal Antibody | anti-CHRNA7 antibody

CHRNA7 Antibody - C-terminal region

Gene Names
CHRNA7; NACHRA7; CHRNA7-2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CHRNA7; Polyclonal Antibody; CHRNA7 Antibody - C-terminal region; anti-CHRNA7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLM
Sequence Length
502
Applicable Applications for anti-CHRNA7 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 77%; Rabbit: 93%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of human CHRNA7
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CHRNA7Sample Type: Liver Tumor lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CHRNA7Sample Type: Liver Tumor lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-CHRNA7 antibody Titration: 1 ug/mLSample Type: Human heart)

Western Blot (WB) (WB Suggested Anti-CHRNA7 antibody Titration: 1 ug/mLSample Type: Human heart)

Western Blot (WB)

(WB Suggested Anti-CHRNA7 antibody Titration: 1 ug/mLSample Type: Human liver)

Western Blot (WB) (WB Suggested Anti-CHRNA7 antibody Titration: 1 ug/mLSample Type: Human liver)
Related Product Information for anti-CHRNA7 antibody
This is a rabbit polyclonal antibody against CHRNA7. It was validated on Western Blot

Target Description: The nicotinic acetylcholine receptors (nAChRs) are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The nAChRs are thought to be hetero-pentamers composed of homologous subunits. The proposed structure for each subunit is a conserved N-terminal extracellular domain followed by three conserved transmembrane domains, a variable cytoplasmic loop, a fourth conserved transmembrane domain, and a short C-terminal extracellular region. The protein encoded by this gene forms a homo-oligomeric channel, displays marked permeability to calcium ions and is a major component of brain nicotinic receptors that are blocked by, and highly sensitive to, alpha-bungarotoxin. Once this receptor binds acetylcholine, it undergoes an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. This gene is located in a region identified as a major susceptibility locus for juvenile myoclonic epilepsy and a chromosomal location involved in the genetic transmission of schizophrenia. An evolutionarily recent partial duplication event in this region results in a hybrid containing sequence from this gene and a novel FAM7A gene. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-CHRNA7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55kDa
NCBI Official Full Name
neuronal acetylcholine receptor subunit alpha-7 isoform 1
NCBI Official Synonym Full Names
cholinergic receptor nicotinic alpha 7 subunit
NCBI Official Symbol
CHRNA7
NCBI Official Synonym Symbols
NACHRA7; CHRNA7-2
NCBI Protein Information
neuronal acetylcholine receptor subunit alpha-7
UniProt Protein Name
Neuronal acetylcholine receptor subunit alpha-7
UniProt Gene Name
CHRNA7
UniProt Synonym Gene Names
NACHRA7
UniProt Entry Name
ACHA7_HUMAN

NCBI Description

The nicotinic acetylcholine receptors (nAChRs) are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The nAChRs are thought to be hetero-pentamers composed of homologous subunits. The proposed structure for each subunit is a conserved N-terminal extracellular domain followed by three conserved transmembrane domains, a variable cytoplasmic loop, a fourth conserved transmembrane domain, and a short C-terminal extracellular region. The protein encoded by this gene forms a homo-oligomeric channel, displays marked permeability to calcium ions and is a major component of brain nicotinic receptors that are blocked by, and highly sensitive to, alpha-bungarotoxin. Once this receptor binds acetylcholine, it undergoes an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. This gene is located in a region identified as a major susceptibility locus for juvenile myoclonic epilepsy and a chromosomal location involved in the genetic transmission of schizophrenia. An evolutionarily recent partial duplication event in this region results in a hybrid containing sequence from this gene and a novel FAM7A gene. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2012]

Uniprot Description

nAChRA7: After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. The channel is blocked by alpha-bungarotoxin. Belongs to the ligand-gated ion channel (TC 1.A.9) family. Acetylcholine receptor (TC 1.A.9.1) subfamily. Alpha- 7/CHRNA7 sub-subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Channel, cation; Membrane protein, multi-pass; Channel, ligand-gated; Membrane protein, integral

Chromosomal Location of Human Ortholog: 15q14

Cellular Component: nicotinic acetylcholine-gated receptor-channel complex; postsynaptic membrane; plasma membrane; integral to membrane; cell junction

Molecular Function: toxin binding; chloride channel regulator activity; protein homodimerization activity; beta-amyloid binding; acetylcholine-gated cation channel activity; acetylcholine receptor activity; nicotinic acetylcholine-activated cation-selective channel activity; acetylcholine binding

Biological Process: response to nicotine; cellular calcium ion homeostasis; synaptic transmission; positive regulation of angiogenesis; activation of MAPK activity; calcium ion transport; positive regulation of cell proliferation; response to hypoxia; ion transport; negative regulation of tumor necrosis factor production; signal transduction; cognition; memory

Disease: Chromosome 15q13.3 Deletion Syndrome

Research Articles on CHRNA7

Similar Products

Product Notes

The CHRNA7 chrna7 (Catalog #AAA3203208) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CHRNA7 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CHRNA7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CHRNA7 chrna7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GQPPEGDPDL AKILEEVRYI ANRFRCQDES EAVCSEWKFA ACVVDRLCLM. It is sometimes possible for the material contained within the vial of "CHRNA7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.