Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human CHMP1A Polyclonal Antibody | anti-CHMP1A antibody

CHMP1A (CHMP1, KIAA0047, PCOLN3, PRSM1, Charged Multivesicular Body Protein 1a, Chromatin-modifying Protein 1a, Vacuolar Protein Sorting-associated Protein 46-1) (MaxLight 405)

Gene Names
CHMP1A; PCH8; CHMP1; PRSM1; PCOLN3; VPS46A; VPS46-1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CHMP1A; Polyclonal Antibody; CHMP1A (CHMP1; KIAA0047; PCOLN3; PRSM1; Charged Multivesicular Body Protein 1a; Chromatin-modifying Protein 1a; Vacuolar Protein Sorting-associated Protein 46-1) (MaxLight 405); anti-CHMP1A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CHMP1A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-CHMP1A antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human CHMP1A, aa1-196 (NP_002759.2).
Immunogen Sequence
MDDTLFQLKFTAKQLEKLAKKAEKDSKAEQAKVKKALLQKNVECARVYAENAIRKKNEGVNWLRMASRVDAVASKVQTAVTMKGVTKNMAQVTKALDKALSTMDLQKVSSVMDRFEQQVQNLDVHTSVMEDSMSSATTLTTPQEQVDSLIMQIAEENGLEVLDQLSQLPEGASAVGESSVRSQEDQLSRRLAALRN
Conjugate
MaxLight405
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-CHMP1A antibody
This gene encodes a member of the CHMP/Chmp family of proteins which are involved in multivesicular body sorting of proteins to the interiors of lysosomes. The initial prediction of the protein sequence encoded by this gene suggested that the encoded protein was a metallopeptidase. The nomenclature has been updated recently to reflect the correct biological function of this encoded protein.
Product Categories/Family for anti-CHMP1A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
7,363 Da
NCBI Official Full Name
charged multivesicular body protein 1a isoform 2
NCBI Official Synonym Full Names
charged multivesicular body protein 1A
NCBI Official Symbol
CHMP1A
NCBI Official Synonym Symbols
PCH8; CHMP1; PRSM1; PCOLN3; VPS46A; VPS46-1
NCBI Protein Information
charged multivesicular body protein 1a; charged multivesicular body protein 1/chromatin modifying protein 1; chromatin modifying protein 1A; procollagen (type III) N-endopeptidase; protease, metallo, 1, 33kD; vacuolar protein sorting-associated protein 46
UniProt Protein Name
Charged multivesicular body protein 1a
UniProt Gene Name
CHMP1A
UniProt Synonym Gene Names
CHMP1; KIAA0047; PCOLN3; PRSM1; CHMP1a; Vps46-1; hVps46-1
UniProt Entry Name
CHM1A_HUMAN

NCBI Description

This gene encodes a member of the CHMP/Chmp family of proteins which are involved in multivesicular body sorting of proteins to the interiors of lysosomes. The initial prediction of the protein sequence encoded by this gene suggested that the encoded protein was a metallopeptidase. The nomenclature has been updated recently to reflect the correct biological function of this encoded protein. Several transcripts encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2012]

Uniprot Description

CHMP1A: Probable peripherally associated component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. The MVB pathway appears to require the sequential function of ESCRT-O, -I,-II and -III complexes. ESCRT- III proteins mostly dissociate from the invaginating membrane before the ILV is released. The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis and the budding of enveloped viruses (HIV-1 and other lentiviruses). ESCRT-III proteins are believed to mediate the necessary vesicle extrusion and/or membrane fission activities, possibly in conjunction with the AAA ATPase VPS4. Involved in cytokinesis. Involved in recruiting VPS4A and/or VPS4B to the midbody of dividing cells. May also be involved in chromosome condensation. Targets the Polycomb group (PcG) protein BMI1/PCGF4 to regions of condensed chromatin. May play a role in stable cell cycle progression and in PcG gene silencing. Belongs to the SNF7 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell cycle regulation; Protease

Chromosomal Location of Human Ortholog: 16q24.3

Cellular Component: nuclear matrix; condensed nuclear chromosome; early endosome; microtubule organizing center; endomembrane system

Molecular Function: protein domain specific binding; protein binding; protein homodimerization activity; metallopeptidase activity; zinc ion binding

Biological Process: cell separation during cytokinesis; transcription, DNA-dependent; mitotic chromosome condensation; negative regulation of transcription by glucose; vacuolar transport; cytokinesis; gene silencing; proteolysis; mitotic metaphase plate congression; vesicle-mediated transport; protein transport; negative regulation of transcription, DNA-dependent; nuclear organization and biogenesis

Disease: Pontocerebellar Hypoplasia, Type 8

Research Articles on CHMP1A

Similar Products

Product Notes

The CHMP1A chmp1a (Catalog #AAA6373911) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CHMP1A (CHMP1, KIAA0047, PCOLN3, PRSM1, Charged Multivesicular Body Protein 1a, Chromatin-modifying Protein 1a, Vacuolar Protein Sorting-associated Protein 46-1) (MaxLight 405) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CHMP1A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CHMP1A chmp1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CHMP1A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.