Mouse anti-Human DBR1 Monoclonal Antibody | anti-DBR1 antibody

DBR1 (Lariat Debranching Enzyme) APC

Cat. Num. AAA6136172

• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: DBR1; Monoclonal Antibody; DBR1 (Lariat Debranching Enzyme) APC; anti-DBR1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3A7
• Specificity: Recognizes human DBR1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-DBR1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa445-539 from human DBR1 (NP_057300) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SGMNTPSVEPSDQASEFSASFSDVRILPGSMIVSSDDTVDSTIDREGKPGGTVESGNGEDLTKVPLKRLSDEHEPEQRKKIKRRNQAIYAAVDD
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.45kD).)

Western Blot (WB)

(Western Blot analysis of DBR1 expression in transfected 293T cell line by DBR1 monoclonal antibody. Lane 1: DBR1 transfected lysate (61.6kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged DBR1 is 0.03ng/ml as a capture antibody.)

Related Product Information for anti-DBR1 antibody

Cleaves the 2'-5' phosphodiester linkage at the branch point of lariat intron pre-mRNAs after splicing and converts them into linear molecules that are subsequently degraded. It thereby facilitates ribonucleotide turnover. It may also participate in retrovirus replication via a RNA lariat intermediate in cDNA synthesis.

Product Categories/Family for anti-DBR1 antibody

Antibodies; Enzymes

NCBI and Uniprot Product Information

• NCBI GI #: 56549113
• NCBI GeneID: 51163
• NCBI Accession #: NP_057300.2
• NCBI GenBank Nucleotide #: NM_016216
• UniProt Accession #: Q9UK59; Q96GH0; Q9NXQ6
• Molecular Weight: 35,022 Da
• NCBI Official Full Name: lariat debranching enzyme
• NCBI Official Synonym Full Names: debranching RNA lariats 1
• NCBI Official Symbol: DBR1
• NCBI Protein Information: lariat debranching enzyme; RNA lariat debranching enzyme; debranching enzyme homolog 1
• UniProt Protein Name: Lariat debranching enzyme
• Protein Family: Lariat debranching enzyme
• UniProt Gene Name: DBR1
• UniProt Entry Name: DBR1_HUMAN

NCBI Description

The protein encoded by this gene is an RNA lariat debranching enzyme that hydrolyzes 2'-5' prime branched phosphodiester bonds. The encoded protein specifically targets the bonds at the branch point of excised lariat intron RNA, converting them to linear molecules that are then degraded. This protein may also be involved in retroviral replication. [provided by RefSeq, Nov 2011]

Uniprot Description

DBR1: Cleaves the 2'-5' phosphodiester linkage at the branch point of lariat intron pre-mRNAs after splicing and converts them into linear molecules that are subsequently degraded. It thereby facilitates ribonucleotide turnover. It may also participate in retrovirus replication via a RNA lariat intermediate in cDNA synthesis. Belongs to the lariat debranching enzyme family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: RNA splicing; Hydrolase; RNA processing; EC 3.1.-.-

Chromosomal Location of Human Ortholog: 3q22.3

Cellular Component: nucleus

Molecular Function: RNA lariat debranching enzyme activity; metal ion binding

Biological Process: RNA splicing, via transesterification reactions; nuclear mRNA splicing, via spliceosome