Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Sample Type: Mouse brainsCHAF1B antibody - N-terminal region validated by WB using Mouse brains at 1:1000.)

Rabbit CHAF1B Polyclonal Antibody | anti-CHAF1B antibody

CHAF1B antibody - N-terminal region

Gene Names
CHAF1B; CAF1; MPP7; CAF-1; CAF1A; CAF1P60; CAF-IP60; MPHOSPH7
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CHAF1B; Polyclonal Antibody; CHAF1B antibody - N-terminal region; anti-CHAF1B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KVITCEIAWHNKEPVYSLDFQHGTAGRIHRLASAGVDTNVRIWKVEKGPD
Sequence Length
559
Applicable Applications for anti-CHAF1B antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CHAF1B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Sample Type: Mouse brainsCHAF1B antibody - N-terminal region validated by WB using Mouse brains at 1:1000.)

Western Blot (WB) (Sample Type: Mouse brainsCHAF1B antibody - N-terminal region validated by WB using Mouse brains at 1:1000.)

Western Blot (WB)

(Host: RabbitTarget Name: CHAF1BSample Type: 293TAntibody Dilution: 1.0ug/mlCHAF1B is supported by BioGPS gene expression data to be expressed in HEK293T)

Western Blot (WB) (Host: RabbitTarget Name: CHAF1BSample Type: 293TAntibody Dilution: 1.0ug/mlCHAF1B is supported by BioGPS gene expression data to be expressed in HEK293T)

Western Blot (WB)

(Host: RabbitTarget Name: CHAF1BSample Type: HepG2Antibody Dilution: 1.0ug/mlCHAF1B is supported by BioGPS gene expression data to be expressed in HepG2)

Western Blot (WB) (Host: RabbitTarget Name: CHAF1BSample Type: HepG2Antibody Dilution: 1.0ug/mlCHAF1B is supported by BioGPS gene expression data to be expressed in HepG2)

Western Blot (WB)

(Host: RabbitTarget Name: CHAF1BSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CHAF1BSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: CHAF1BSample Type: JurkatAntibody Dilution: 1.0ug/mlCHAF1B is supported by BioGPS gene expression data to be expressed in Jurkat)

Western Blot (WB) (Host: RabbitTarget Name: CHAF1BSample Type: JurkatAntibody Dilution: 1.0ug/mlCHAF1B is supported by BioGPS gene expression data to be expressed in Jurkat)

Western Blot (WB)

(WB Suggested Anti-CHAF1B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Liver)

Western Blot (WB) (WB Suggested Anti-CHAF1B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Liver)
Related Product Information for anti-CHAF1B antibody
This is a rabbit polyclonal antibody against CHAF1B. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Chromatin assembly factor I (CAF-I) is required for the assembly of histone octamers onto newly-replicated DNA. CAF-I is composed of three protein subunits, p50, p60, and p150. CHAF1B corresponds to the p60 subunit and is required for chromatin assembly after replication. CHAF1B is differentially phosphorylated in a cell cycle-dependent manner. In addition, it is normally found in the nucleus except during mitosis, when it is released into the cytoplasm. This protein is a member of the WD-repeat HIR1 family and may also be involved in DNA repair. Chromatin assembly factor I (CAF-I) is required for the assembly of histone octamers onto newly-replicated DNA. CAF-I is composed of three protein subunits, p50, p60, and p150. The protein encoded by this gene corresponds to the p60 subunit and is required for chromatin assembly after replication. The encoded protein is differentially phosphorylated in a cell cycle-dependent manner. In addition, it is normally found in the nucleus except during mitosis, when it is released into the cytoplasm. This protein is a member of the WD-repeat HIR1 family and may also be involved in DNA repair. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61kDa
NCBI Official Full Name
chromatin assembly factor 1 subunit B
NCBI Official Synonym Full Names
chromatin assembly factor 1 subunit B
NCBI Official Symbol
CHAF1B
NCBI Official Synonym Symbols
CAF1; MPP7; CAF-1; CAF1A; CAF1P60; CAF-IP60; MPHOSPH7
NCBI Protein Information
chromatin assembly factor 1 subunit B
UniProt Protein Name
Chromatin assembly factor 1 subunit B
Protein Family
UniProt Gene Name
CHAF1B
UniProt Synonym Gene Names
CAF1A; CAF1P60; MPHOSPH7; MPP7; CAF-1 subunit B; CAF-I 60 kDa subunit; CAF-I p60
UniProt Entry Name
CAF1B_HUMAN

NCBI Description

Chromatin assembly factor I (CAF-I) is required for the assembly of histone octamers onto newly-replicated DNA. CAF-I is composed of three protein subunits, p50, p60, and p150. The protein encoded by this gene corresponds to the p60 subunit and is required for chromatin assembly after replication. The encoded protein is differentially phosphorylated in a cell cycle-dependent manner. In addition, it is normally found in the nucleus except during mitosis, when it is released into the cytoplasm. This protein is a member of the WD-repeat HIR1 family and may also be involved in DNA repair. [provided by RefSeq, Jul 2008]

Uniprot Description

CAF-1B: Complex that is thought to mediate chromatin assembly in DNA replication and DNA repair. Assembles histone octamers onto replicating DNA in vitro. CAF-1 performs the first step of the nucleosome assembly process, bringing newly synthesized histones H3 and H4 to replicating DNA; histones H2A/H2B can bind to this chromatin precursor subsequent to DNA replication to complete the histone octamer. The CCR4-NOT complex functions as general transcription regulation complex. Belongs to the WD repeat HIR1 family.

Protein type: DNA replication

Chromosomal Location of Human Ortholog: 21q22.13

Cellular Component: nucleoplasm; protein complex; cytoplasm; nuclear chromatin; cytosol; nucleus

Molecular Function: histone binding; unfolded protein binding; chromatin binding

Biological Process: transcription, DNA-dependent; regulation of transcription, DNA-dependent; chromatin assembly; protein complex assembly; cell cycle; reproduction; DNA repair; DNA replication; DNA replication-dependent nucleosome assembly

Research Articles on CHAF1B

Similar Products

Product Notes

The CHAF1B chaf1b (Catalog #AAA3207933) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CHAF1B antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CHAF1B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CHAF1B chaf1b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KVITCEIAWH NKEPVYSLDF QHGTAGRIHR LASAGVDTNV RIWKVEKGPD. It is sometimes possible for the material contained within the vial of "CHAF1B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.