Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CEACAM1Sample Type: MCF7 Whole cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human CEACAM1 Polyclonal Antibody | anti-CEACAM1 antibody

CEACAM1 Antibody - C-terminal region

Gene Names
CEACAM1; BGP; BGP1; BGPI
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CEACAM1; Polyclonal Antibody; CEACAM1 Antibody - C-terminal region; anti-CEACAM1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ACFLHFGKTGRASDQRDLTEHKPSVSNHTQDHSNDPPNKMNEVTYSTLNF
Sequence Length
526
Applicable Applications for anti-CEACAM1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human CEACAM1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CEACAM1Sample Type: MCF7 Whole cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CEACAM1Sample Type: MCF7 Whole cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-CEACAM1 antibody
This is a rabbit polyclonal antibody against CEACAM1. It was validated on Western Blot

Target Description: This gene encodes a member of the carcinoembryonic antigen (CEA) gene family, which belongs to the immunoglobulin superfamily. Two subgroups of the CEA family, the CEA cell adhesion molecules and the pregnancy-specific glycoproteins, are located within a 1.2 Mb cluster on the long arm of chromosome 19. Eleven pseudogenes of the CEA cell adhesion molecule subgroup are also found in the cluster. The encoded protein was originally described in bile ducts of liver as biliary glycoprotein. Subsequently, it was found to be a cell-cell adhesion molecule detected on leukocytes, epithelia, and endothelia. The encoded protein mediates cell adhesion via homophilic as well as heterophilic binding to other proteins of the subgroup. Multiple cellular activities have been attributed to the encoded protein, including roles in the differentiation and arrangement of tissue three-dimensional structure, angiogenesis, apoptosis, tumor suppression, metastasis, and the modulation of innate and adaptive immune responses. Multiple transcript variants encoding different isoforms have been reported, but the full-length nature of all variants has not been defined.
Product Categories/Family for anti-CEACAM1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
634
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57kDa
NCBI Official Full Name
carcinoembryonic antigen-related cell adhesion molecule 1 isoform 1
NCBI Official Synonym Full Names
carcinoembryonic antigen related cell adhesion molecule 1
NCBI Official Symbol
CEACAM1
NCBI Official Synonym Symbols
BGP; BGP1; BGPI
NCBI Protein Information
carcinoembryonic antigen-related cell adhesion molecule 1
UniProt Protein Name
Carcinoembryonic antigen-related cell adhesion molecule 1
Protein Family
UniProt Gene Name
CEACAM1
UniProt Synonym Gene Names
BGP; BGP1; BGP-1
UniProt Entry Name
CEAM1_HUMAN

NCBI Description

This gene encodes a member of the carcinoembryonic antigen (CEA) gene family, which belongs to the immunoglobulin superfamily. Two subgroups of the CEA family, the CEA cell adhesion molecules and the pregnancy-specific glycoproteins, are located within a 1.2 Mb cluster on the long arm of chromosome 19. Eleven pseudogenes of the CEA cell adhesion molecule subgroup are also found in the cluster. The encoded protein was originally described in bile ducts of liver as biliary glycoprotein. Subsequently, it was found to be a cell-cell adhesion molecule detected on leukocytes, epithelia, and endothelia. The encoded protein mediates cell adhesion via homophilic as well as heterophilic binding to other proteins of the subgroup. Multiple cellular activities have been attributed to the encoded protein, including roles in the differentiation and arrangement of tissue three-dimensional structure, angiogenesis, apoptosis, tumor suppression, metastasis, and the modulation of innate and adaptive immune responses. Multiple transcript variants encoding different isoforms have been reported, but the full-length nature of all variants has not been defined. [provided by RefSeq, May 2010]

Uniprot Description

CEACAM1: carcinoembryonic antigen-related cell adhesion molecule 1. A cell-cell adhesion molecule that directly associates with annexin II. Has tumor suppressor activity in prostate carcinoma. Belongs to the immunoglobulin superfamily and the CEA family. Abundantly expressed in epithelia, vessel endothelia, trophoblasts, platelets and neutrophilic granulocytes. Also present in many cell types of the immune system such as B cells, T cells, NK cells, macrophages and dendritic cells. Five alternatively spliced isoforms have been described. Two isoforms are type I membrane proteins, while three are secreted.

Protein type: Membrane protein, integral; Motility/polarity/chemotaxis; Immunoglobulin superfamily; Cell adhesion

Chromosomal Location of Human Ortholog: 19q13.2

Cellular Component: membrane; integral to plasma membrane; integral to membrane; plasma membrane

Molecular Function: protein binding; protein homodimerization activity

Biological Process: integrin-mediated signaling pathway; cell migration; angiogenesis; homophilic cell adhesion; blood coagulation; leukocyte migration

Research Articles on CEACAM1

Similar Products

Product Notes

The CEACAM1 ceacam1 (Catalog #AAA3219383) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CEACAM1 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CEACAM1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CEACAM1 ceacam1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ACFLHFGKTG RASDQRDLTE HKPSVSNHTQ DHSNDPPNKM NEVTYSTLNF. It is sometimes possible for the material contained within the vial of "CEACAM1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.