Mouse CEACAM1 Monoclonal Antibody | anti-CEACAM1 antibody

CEACAM1 (Carcinoembryonic antigen-Related Cell Adhesion Molecule 1 (biliary Glycoprotein), BGP, BGP1, BGPI) (PE)

Cat. Num. AAA6186231

• Gene Names: CEACAM1; BGP; BGP1; BGPI
• Applications: ELISA
• Purity: Purified
• Synonyms: CEACAM1; Monoclonal Antibody; CEACAM1 (Carcinoembryonic antigen-Related Cell Adhesion Molecule 1 (biliary Glycoprotein); BGP; BGP1; BGPI) (PE); Carcinoembryonic antigen-Related Cell Adhesion Molecule 1 (biliary Glycoprotein); BGPI; anti-CEACAM1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2F9
• Specificity: Recognizes CEACAM1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 468

• Applicable Applications for anti-CEACAM1 antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: CEACAM1 (AAH14473, 305aa-414aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: VTGCNRTTVKTIIVTELSPVVAKPQIKASKTTVTGDKDSVNLTCSTNDTGISIRWFFKNQSLPSSERMKLSQGNTTLSINPVKREDAGTYWCEVFNPISKNQSDPIMLNV
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged CEACAM1 is approximately 0.3ng/ml as a capture antibody.)

Related Product Information for anti-CEACAM1 antibody

This gene encodes a member of the carcinoembryonic antigen (CEA) gene family, which belongs to the immunoglobulin superfamily. Two subgroups of the CEA family, the CEA cell adhesion molecules and the pregnancy-specific glycoproteins, are located within a 1.2 Mb cluster on the long arm of chromosome 19. Eleven pseudogenes of the CEA cell adhesion molecule subgroup are also found in the cluster. The encoded protein was originally described in bile ducts of liver as biliary glycoprotein. Subsequently, it was found to be a cell-cell adhesion molecule detected on leukocytes, epithelia, and endothelia. The encoded protein mediates cell adhesion via homophilic as well as heterophilic binding to other proteins of the subgroup. Multiple cellular activities have been attributed to the encoded protein, including roles in the differentiation and arrangement of tissue three-dimensional structure, angiogenesis, apoptosis, tumor suppression, metastasis, and the modulation of innate and adaptive immune responses. Multiple transcript variants encoding different isoforms have been reported, but the full-length nature of only two has been determined. [provided by RefSeq]

Product Categories/Family for anti-CEACAM1 antibody

Antibodies; Cancer Markers

NCBI and Uniprot Product Information

• NCBI GI #: 15680237
• NCBI GeneID: 634
• NCBI Official Full Name: CEACAM1 protein
• NCBI Official Synonym Full Names: CEA cell adhesion molecule 1
• NCBI Official Symbol: CEACAM1
• NCBI Official Synonym Symbols: BGP; BGP1; BGPI
• NCBI Protein Information: carcinoembryonic antigen-related cell adhesion molecule 1
• Protein Family: CEACAM1-like protein

NCBI Description

This gene encodes a member of the carcinoembryonic antigen (CEA) gene family, which belongs to the immunoglobulin superfamily. Two subgroups of the CEA family, the CEA cell adhesion molecules and the pregnancy-specific glycoproteins, are located within a 1.2 Mb cluster on the long arm of chromosome 19. Eleven pseudogenes of the CEA cell adhesion molecule subgroup are also found in the cluster. The encoded protein was originally described in bile ducts of liver as biliary glycoprotein. Subsequently, it was found to be a cell-cell adhesion molecule detected on leukocytes, epithelia, and endothelia. The encoded protein mediates cell adhesion via homophilic as well as heterophilic binding to other proteins of the subgroup. Multiple cellular activities have been attributed to the encoded protein, including roles in the differentiation and arrangement of tissue three-dimensional structure, angiogenesis, apoptosis, tumor suppression, metastasis, and the modulation of innate and adaptive immune responses. Multiple transcript variants encoding different isoforms have been reported, but the full-length nature of all variants has not been defined. [provided by RefSeq, May 2010]