Immunohistochemistry (IHC)
(Sample Type: Diseased Human ProstateSample Type :Diseased Human ProstatePrimary Antibody Dilution :20ug/mLColor/Signal Descriptions:CDKN1A (DAB; brown), nuclei (hematoxylin; blue)Gene Name:CDKN1A)
Rabbit CDKN1A Polyclonal Antibody | anti-CDKN1A antibody
CDKN1A Antibody - N-terminal region
Gene Names
CDKN1A; P21; CIP1; SDI1; WAF1; CAP20; CDKN1; MDA-6; p21CIP1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
CDKN1A; Polyclonal Antibody; CDKN1A Antibody - N-terminal region; anti-CDKN1A antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KACRRLFGPVDSEQLSRDCDALMAGCIQEARERWNFDFVTETPLEGDFAW
Sequence Length
164
Applicable Applications for anti-CDKN1A antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 92%; Guinea Pig: 92%; Horse: 83%; Human: 100%; Mouse: 92%; Pig: 100%; Rabbit: 92%; Rat: 100%; Sheep: 100%; Zebrafish: 83%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human CDKN1A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Sample Type: Diseased Human ProstateSample Type :Diseased Human ProstatePrimary Antibody Dilution :20ug/mLColor/Signal Descriptions:CDKN1A (DAB; brown), nuclei (hematoxylin; blue)Gene Name:CDKN1A)
Immunohistochemistry (IHC)
(Sample Type: Diseased Human ProstateSample Type :Diseased Human ProstatePrimary Antibody Dilution :20ug/mLColor/Signal Descriptions:CDKN1A (DAB; brown), nuclei (hematoxylin; blue)Gene Name:CDKN1A)
Related Product Information for anti-CDKN1A antibody
This is a rabbit polyclonal antibody against CDKN1A. It was validated on Western Blot
Target Description: This gene encodes a potent cyclin-dependent kinase inhibitor. The encoded protein binds to and inhibits the activity of cyclin-CDK2 or -CDK4 complexes, and thus functions as a regulator of cell cycle progression at G1. The expression of this gene is tightly controlled by the tumor suppressor protein p53, through which this protein mediates the p53-dependent cell cycle G1 phase arrest in response to a variety of stress stimuli. This protein can interact with proliferating cell nuclear antigen (PCNA), a DNA polymerase accessory factor, and plays a regulatory role in S phase DNA replication and DNA damage repair. This protein was reported to be specifically cleaved by CASP3-like caspases, which thus leads to a dramatic activation of CDK2, and may be instrumental in the execution of apoptosis following caspase activation. Multiple alternatively spliced variants have been found for this gene.
Target Description: This gene encodes a potent cyclin-dependent kinase inhibitor. The encoded protein binds to and inhibits the activity of cyclin-CDK2 or -CDK4 complexes, and thus functions as a regulator of cell cycle progression at G1. The expression of this gene is tightly controlled by the tumor suppressor protein p53, through which this protein mediates the p53-dependent cell cycle G1 phase arrest in response to a variety of stress stimuli. This protein can interact with proliferating cell nuclear antigen (PCNA), a DNA polymerase accessory factor, and plays a regulatory role in S phase DNA replication and DNA damage repair. This protein was reported to be specifically cleaved by CASP3-like caspases, which thus leads to a dramatic activation of CDK2, and may be instrumental in the execution of apoptosis following caspase activation. Multiple alternatively spliced variants have been found for this gene.
Product Categories/Family for anti-CDKN1A antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
18kDa
NCBI Official Full Name
cyclin-dependent kinase inhibitor 1 isoform 1
NCBI Official Synonym Full Names
cyclin dependent kinase inhibitor 1A
NCBI Official Symbol
CDKN1A
NCBI Official Synonym Symbols
P21; CIP1; SDI1; WAF1; CAP20; CDKN1; MDA-6; p21CIP1
NCBI Protein Information
cyclin-dependent kinase inhibitor 1
UniProt Protein Name
Cyclin-dependent kinase inhibitor 1
UniProt Gene Name
CDKN1A
UniProt Synonym Gene Names
CAP20; CDKN1; CIP1; MDA6; PIC1; SDI1; WAF1; MDA-6
UniProt Entry Name
CDN1A_HUMAN
NCBI Description
This gene encodes a potent cyclin-dependent kinase inhibitor. The encoded protein binds to and inhibits the activity of cyclin-cyclin-dependent kinase2 or -cyclin-dependent kinase4 complexes, and thus functions as a regulator of cell cycle progression at G1. The expression of this gene is tightly controlled by the tumor suppressor protein p53, through which this protein mediates the p53-dependent cell cycle G1 phase arrest in response to a variety of stress stimuli. This protein can interact with proliferating cell nuclear antigen, a DNA polymerase accessory factor, and plays a regulatory role in S phase DNA replication and DNA damage repair. This protein was reported to be specifically cleaved by CASP3-like caspases, which thus leads to a dramatic activation of cyclin-dependent kinase2, and may be instrumental in the execution of apoptosis following caspase activation. Mice that lack this gene have the ability to regenerate damaged or missing tissue. Multiple alternatively spliced variants have been found for this gene. [provided by RefSeq, Sep 2015]
Research Articles on CDKN1A
Similar Products
Product Notes
The CDKN1A cdkn1a (Catalog #AAA3200191) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CDKN1A Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CDKN1A can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the CDKN1A cdkn1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KACRRLFGPV DSEQLSRDCD ALMAGCIQEA RERWNFDFVT ETPLEGDFAW. It is sometimes possible for the material contained within the vial of "CDKN1A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
