Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-CDK2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Liver TissueObserved Staining: Cytoplasm in Kupffer cellsPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit CDK2 Polyclonal Antibody | anti-CDK2 antibody

CDK2 antibody - middle region

Gene Names
CDK2; CDKN2; p33(CDK2)
Reactivity
Cow, Goat, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
CDK2; Polyclonal Antibody; CDK2 antibody - middle region; anti-CDK2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Goat, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVVTLWYRAPE
Sequence Length
298
Applicable Applications for anti-CDK2 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Homology
Cow: 100%; Goat: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-CDK2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Liver TissueObserved Staining: Cytoplasm in Kupffer cellsPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (Rabbit Anti-CDK2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Liver TissueObserved Staining: Cytoplasm in Kupffer cellsPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-CDK2 antibody
This is a rabbit polyclonal antibody against CDK2. It was validated on Western Blot

Target Description: Phospho-cdk2 (Thr160) probably involved in the control of the cell cycle. It interacts with cyclins A, D, or E. Activity of cdk2 is maximal during S phase and G2.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
cyclin-dependent kinase 2 isoform 1
NCBI Official Synonym Full Names
cyclin dependent kinase 2
NCBI Official Symbol
CDK2
NCBI Official Synonym Symbols
CDKN2; p33(CDK2)
NCBI Protein Information
cyclin-dependent kinase 2
UniProt Protein Name
Cyclin-dependent kinase 2
Protein Family
UniProt Gene Name
CDK2
UniProt Synonym Gene Names
CDKN2
UniProt Entry Name
CDK2_HUMAN

NCBI Description

This gene encodes a member of a family of serine/threonine protein kinases that participate in cell cycle regulation. The encoded protein is the catalytic subunit of the cyclin-dependent protein kinase complex, which regulates progression through the cell cycle. Activity of this protein is especially critical during the G1 to S phase transition. This protein associates with and regulated by other subunits of the complex including cyclin A or E, CDK inhibitor p21Cip1 (CDKN1A), and p27Kip1 (CDKN1B). Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2014]

Uniprot Description

CDK2: a protein kinase of the CDK family. An important component of the cell cycle machinery. Activity of CDK2 is maximal during S phase and G2. Cdk2/cyclin E kinase activity is important for the G1 to S transition and phosphorylates the Rb protein. In S-phase, active cdk2/cyclin A complexes predominate and phosphorylate E2F, and the active cdk2 complex persists in the nucleus through G2. Part of the Rb pathway disregulated in most tumors. Target of several candidate cancer drugs. However, inhibition does not always prevent cancer cell growth, possibly due to CDK redundancy. Inhibitors: BMS-265246, BMS-265246-01, R-roscovitine (CYC200, CYC202), SU9516, R547, L868276

Protein type: Protein kinase, CMGC; EC 2.7.11.22; Protein kinase, Ser/Thr (non-receptor); Cell cycle regulation; Kinase, protein; CMGC group; CDK family; CDK1 subfamily; CDK/CDK1 subfamily

Chromosomal Location of Human Ortholog: 12q13

Cellular Component: nucleoplasm; Y chromosome; Cajal body; centrosome; chromosome, telomeric region; transcription factor complex; X chromosome; cytoplasm; cyclin-dependent protein kinase holoenzyme complex; condensed chromosome; nucleus; cytosol; endosome

Molecular Function: cyclin binding; protein binding; cyclin-dependent protein kinase activity; metal ion binding; histone kinase activity; ATP binding

Biological Process: G1 DNA damage checkpoint; mitosis; meiosis; histone phosphorylation; positive regulation of transcription, DNA-dependent; DNA repair; DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest; peptidyl-serine phosphorylation; regulation of ubiquitin-protein ligase activity during mitotic cell cycle; cell division; anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process; Ras protein signal transduction; positive regulation of cell proliferation; mitotic cell cycle; blood coagulation; DNA replication; G2/M transition of mitotic cell cycle; centrosome duplication; potassium ion transport; positive regulation of DNA replication initiation; G1/S transition of mitotic cell cycle

Research Articles on CDK2

Similar Products

Product Notes

The CDK2 cdk2 (Catalog #AAA3200220) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CDK2 antibody - middle region reacts with Cow, Goat, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CDK2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). Researchers should empirically determine the suitability of the CDK2 cdk2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VLHRDLKPQN LLINTEGAIK LADFGLARAF GVPVRTYTHE VVTLWYRAPE. It is sometimes possible for the material contained within the vial of "CDK2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.