Testing Data
(Detection limit for recombinant GST tagged PLA2G16 is 0.1 ng/ml as a capture antibody.)
Mouse PLA2G16 Monoclonal Antibody | anti-PLA2G16 antibody
PLA2G16 (Phospholipase A2, Group XVI, AdPLA, H-REV107-1, HRASLS3, HREV107, HREV107-3, MGC118754) (AP)
Gene Names
PLAAT3; AdPLA; HRSL3; HRASLS3; HREV107; PLA2G16; PLAAT-3; H-REV107; HREV107-1; HREV107-3; H-REV107-1
Applications
Western Blot
Purity
Purified
Synonyms
PLA2G16; Monoclonal Antibody; PLA2G16 (Phospholipase A2; Group XVI; AdPLA; H-REV107-1; HRASLS3; HREV107; HREV107-3; MGC118754) (AP); Phospholipase A2; MGC118754; anti-PLA2G16 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4C4-2A11
Specificity
Recognizes PLA2G16.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
162
Applicable Applications for anti-PLA2G16 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PLA2G16 (AAH01387, 1aa-162aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRDVIIAASVAGMGLAAMSLIGVMFSRNKRQKQ
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged PLA2G16 is 0.1 ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged PLA2G16 is 0.1 ng/ml as a capture antibody.)
Western Blot (WB)
(Western Blot analysis of PLA2G16 expression in transfected 293T cell line by PLA2G16 monoclonal antibody (M02), clone 4C4-2A11.Lane 1: PLA2G16 transfected lysate (Predicted MW: 17.9 KDa).Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of PLA2G16 expression in transfected 293T cell line by PLA2G16 monoclonal antibody (M02), clone 4C4-2A11.Lane 1: PLA2G16 transfected lysate (Predicted MW: 17.9 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-PLA2G16 antibody
Mouse monoclonal antibody raised against a full-length recombinant PLA2G16.
Product Categories/Family for anti-PLA2G16 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
Phospholipase A2, group XVI
NCBI Official Synonym Full Names
phospholipase A and acyltransferase 3
NCBI Official Symbol
PLAAT3
NCBI Official Synonym Symbols
AdPLA; HRSL3; HRASLS3; HREV107; PLA2G16; PLAAT-3; H-REV107; HREV107-1; HREV107-3; H-REV107-1
NCBI Protein Information
phospholipase A and acyltransferase 3
Protein Family
Research Articles on PLA2G16
Similar Products
Product Notes
The PLA2G16 (Catalog #AAA6164942) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PLA2G16 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PLA2G16 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PLA2G16, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
