Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CDK10Sample Type: MCF7 Whole cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human CDK10 Polyclonal Antibody | anti-CDK10 antibody

CDK10 Antibody - C-terminal region

Gene Names
CDK10; ALSAS; PISSLRE
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CDK10; Polyclonal Antibody; CDK10 Antibody - C-terminal region; anti-CDK10 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LGTPSENIWPGFSKLPLVGQYSLRKQPYNNLKHKFPWLSEAGLRLLHFLF
Sequence Length
360
Applicable Applications for anti-CDK10 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human CDK10
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CDK10Sample Type: MCF7 Whole cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CDK10Sample Type: MCF7 Whole cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-CDK10 antibody
This is a rabbit polyclonal antibody against CDK10. It was validated on Western Blot

Target Description: The protein encoded by this gene belongs to the CDK subfamily of the Ser/Thr protein kinase family. The CDK subfamily members are highly similar to the gene products of S. cerevisiae cdc28, and S. pombe cdc2, and are known to be essential for cell cycle progression. This kinase has been shown to play a role in cellular proliferation and its function is limited to cell cycle G2-M phase. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-CDK10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
cyclin-dependent kinase 10 isoform c
NCBI Official Synonym Full Names
cyclin dependent kinase 10
NCBI Official Symbol
CDK10
NCBI Official Synonym Symbols
ALSAS; PISSLRE
NCBI Protein Information
cyclin-dependent kinase 10
UniProt Protein Name
Cyclin-dependent kinase 10
Protein Family
UniProt Gene Name
CDK10
UniProt Entry Name
CDK10_HUMAN

NCBI Description

The protein encoded by this gene belongs to the CDK subfamily of the Ser/Thr protein kinase family. The CDK subfamily members are highly similar to the gene products of S. cerevisiae cdc28, and S. pombe cdc2, and are known to be essential for cell cycle progression. This kinase has been shown to play a role in cellular proliferation and its function is limited to cell cycle G2-M phase. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2009]

Uniprot Description

CDK10: a CMGC kinase of the CDK family. Plays a role in cellular proliferation. Its function is limited to cell cycle G2-M phase. At least three alternatively spliced isoforms have been reported, two of which contain multiple non-AUG translation initiation sites.

Protein type: Kinase, protein; Protein kinase, CMGC; EC 2.7.11.22; Protein kinase, Ser/Thr (non-receptor); Cell cycle regulation; CMGC group; CDK family; CDK10 subfamily; CDK/CDK10 subfamily

Chromosomal Location of Human Ortholog: 16q24

Molecular Function: protein binding; cyclin-dependent protein kinase activity; ATP binding

Biological Process: negative regulation of cell proliferation; traversing start control point of mitotic cell cycle; positive regulation of MAPKKK cascade; protein amino acid phosphorylation

Research Articles on CDK10

Similar Products

Product Notes

The CDK10 cdk10 (Catalog #AAA3219252) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CDK10 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CDK10 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CDK10 cdk10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LGTPSENIWP GFSKLPLVGQ YSLRKQPYNN LKHKFPWLSE AGLRLLHFLF. It is sometimes possible for the material contained within the vial of "CDK10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.