Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CDC14BSample Tissue: Human HT1080 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human CDC14B Polyclonal Antibody | anti-CDC14B antibody

CDC14B Antibody - middle region

Gene Names
CDC14B; CDC14B3; Cdc14B1; Cdc14B2; hCDC14B
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CDC14B; Polyclonal Antibody; CDC14B Antibody - middle region; anti-CDC14B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGYHQH
Sequence Length
459
Applicable Applications for anti-CDC14B antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CDC14B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CDC14BSample Tissue: Human HT1080 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CDC14BSample Tissue: Human HT1080 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-CDC14B antibody
The protein encoded by this gene is a member of the dual specificity protein tyrosine phosphatase family. This protein is highly similar to Saccharomyces cerevisiae Cdc14, a protein tyrosine phosphatase involved in the exit of cell mitosis and initiation of DNA replication, which suggests the role in cell cycle control. This protein has been shown to interact with and dephosphorylates tumor suppressor protein p53, and is thought to regulate the function of p53. Alternative splice of this gene results in 3 transcript variants encoding distinct isoforms.
Product Categories/Family for anti-CDC14B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50 kDa
NCBI Official Full Name
dual specificity protein phosphatase CDC14B isoform 3
NCBI Official Synonym Full Names
cell division cycle 14B
NCBI Official Symbol
CDC14B
NCBI Official Synonym Symbols
CDC14B3; Cdc14B1; Cdc14B2; hCDC14B
NCBI Protein Information
dual specificity protein phosphatase CDC14B
UniProt Protein Name
Dual specificity protein phosphatase CDC14B
UniProt Gene Name
CDC14B
UniProt Entry Name
CC14B_HUMAN

NCBI Description

The protein encoded by this gene is a member of the dual specificity protein tyrosine phosphatase family. This protein is highly similar to Saccharomyces cerevisiae Cdc14, a protein tyrosine phosphatase involved in the exit of cell mitosis and initiation of DNA replication, which suggests the role in cell cycle control. This protein has been shown to interact with and dephosphorylates tumor suppressor protein p53, and is thought to regulate the function of p53. Alternative splice of this gene results in 3 transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

CDC14B: Dual-specificity phosphatase involved in DNA damage response. Essential regulator of the G2 DNA damage checkpoint: following DNA damage, translocates to the nucleus and dephosphorylates FZR1/CDH1, a key activator of the anaphase promoting complex/cyclosome (APC/C). Dephosphorylation of FZR1/CDH1 activates the APC/C, leading to the ubiquitination of PLK1, preventing entry into mitosis. Preferentially dephosphorylates proteins modified by proline-directed kinases. Belongs to the protein-tyrosine phosphatase family. Non-receptor class CDC14 subfamily. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.1.3.48; Motility/polarity/chemotaxis; Nucleolus; EC 3.1.3.16; Protein phosphatase, dual-specificity

Chromosomal Location of Human Ortholog: 9q22.3

Cellular Component: nucleoplasm; nuclear membrane; nucleolus; nucleus

Molecular Function: protein binding; protein tyrosine/serine/threonine phosphatase activity; protein tyrosine phosphatase activity; protein serine/threonine phosphatase activity

Biological Process: anaphase-promoting complex activation; protein amino acid dephosphorylation; G2/M transition DNA damage checkpoint; DNA repair

Research Articles on CDC14B

Similar Products

Product Notes

The CDC14B cdc14b (Catalog #AAA3222515) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CDC14B Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CDC14B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CDC14B cdc14b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FLNFNSFNLD EYEHYEKAEN GDLNWIIPDR FIAFCGPHSR ARLESGYHQH. It is sometimes possible for the material contained within the vial of "CDC14B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.