Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of extracts of various cells, using 210017.)

Rabbit anti-Human, Mouse CD9 Polyclonal Antibody | anti-CD9 antibody

CD9 (Tetraspanin 29, 5H9, BA2, BTCC-1, DRAP-27, GIG2, MIC3, MRP-1, P24, TSPAN29) (Biotin)

Gene Names
CD9; MIC3; MRP-1; BTCC-1; DRAP-27; TSPAN29; TSPAN-29
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by affinity chromatography.
Synonyms
CD9; Polyclonal Antibody; CD9 (Tetraspanin 29; 5H9; BA2; BTCC-1; DRAP-27; GIG2; MIC3; MRP-1; P24; TSPAN29) (Biotin); anti-CD9 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CD9. Species Crossreactivity: mouse
Purity/Purification
Purified by affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-CD9 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Recombinant fusion protein corresponding to aa112-195 from human CD9.
Immunogen Sequence
SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of extracts of various cells, using 210017.)

Western Blot (WB) (Western Blot analysis of extracts of various cells, using 210017.)

Western Blot (WB)

(Western Blot analysis of extracts of mouse kidney (25ug), using 210017 (1:1000). Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (1:10,000). Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit.)

Western Blot (WB) (Western Blot analysis of extracts of mouse kidney (25ug), using 210017 (1:1000). Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (1:10,000). Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit.)

Testing Data

()

Testing Data ()
Related Product Information for anti-CD9 antibody
This gene encodes a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Tetraspanins are cell surface glycoproteins with four transmembrane domains that form multimeric complexes with other cell surface proteins. The encoded protein functions in many cellular processes including differentiation, adhesion, and signal transduction, and expression of this gene plays a critical role in the suppression of cancer cell motility and metastasis.
Product Categories/Family for anti-CD9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
928
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25,416 Da
NCBI Official Full Name
CD9 antigen
NCBI Official Synonym Full Names
CD9 molecule
NCBI Official Symbol
CD9
NCBI Official Synonym Symbols
MIC3; MRP-1; BTCC-1; DRAP-27; TSPAN29; TSPAN-29
NCBI Protein Information
CD9 antigen
UniProt Protein Name
CD9 antigen
Protein Family
UniProt Gene Name
CD9
UniProt Synonym Gene Names
MIC3; TSPAN29; MRP-1; Tspan-29
UniProt Entry Name
CD9_HUMAN

Uniprot Description

CD9: Involved in platelet activation and aggregation. Regulates paranodal junction formation. Involved in cell adhesion, cell motility and tumor metastasis. Required for sperm-egg fusion. Belongs to the tetraspanin (TM4SF) family.

Protein type: Motility/polarity/chemotaxis; Membrane protein, multi-pass; Cell adhesion; Membrane protein, integral

Chromosomal Location of Human Ortholog: 12p13.3

Cellular Component: extracellular space; platelet alpha granule membrane; focal adhesion; integral to plasma membrane; apical plasma membrane; plasma membrane; vesicle; external side of plasma membrane

Molecular Function: integrin binding; protein binding

Biological Process: negative regulation of cell proliferation; platelet activation; platelet degranulation; fusion of sperm to egg plasma membrane; single fertilization; pathogenesis; brain development; cell adhesion; cell motility; blood coagulation; oligodendrocyte development; response to water deprivation; multicellular organism reproduction; paranodal junction assembly

Similar Products

Product Notes

The CD9 cd9 (Catalog #AAA6410515) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD9 (Tetraspanin 29, 5H9, BA2, BTCC-1, DRAP-27, GIG2, MIC3, MRP-1, P24, TSPAN29) (Biotin) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's CD9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CD9 cd9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CD9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.