Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Hemoglobin subunit zeta (HBZ) Recombinant Protein | HBZ recombinant protein

Recombinant Human Hemoglobin subunit zeta (HBZ)

Gene Names
HBZ; HBZ1; HBZ-T1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Hemoglobin subunit zeta (HBZ); Recombinant Human Hemoglobin subunit zeta (HBZ); Hemoglobin subunit zeta; HBAZ; Hemoglobin zeta chain; Zeta-globin; HBZ recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-142aa; Full Length
Sequence
SLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGALSKLSELHAYILRVDPVNFKLLSHCLLVTLAARFPADFTAEAHAAWDKFLSVVSSVLTEKYR
Sequence Length
141
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

SDS-PAGE
Related Product Information for HBZ recombinant protein
The zeta chain is an alpha-type chain of mammalian embryonic hemoglobin.
Product Categories/Family for HBZ recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42.5 kDa
NCBI Official Full Name
hemoglobin subunit zeta
NCBI Official Synonym Full Names
hemoglobin, zeta
NCBI Official Symbol
HBZ
NCBI Official Synonym Symbols
HBZ1; HBZ-T1
NCBI Protein Information
hemoglobin subunit zeta; HBAZ; zeta-globin; hemoglobin zeta chain
UniProt Protein Name
Hemoglobin subunit zeta
Protein Family
UniProt Gene Name
HBZ
UniProt Synonym Gene Names
HBZ2
UniProt Entry Name
HBAZ_HUMAN

NCBI Description

Zeta-globin is an alpha-like hemoglobin. The zeta-globin polypeptide is synthesized in the yolk sac of the early embryo, while alpha-globin is produced throughout fetal and adult life. The zeta-globin gene is a member of the human alpha-globin gene cluster that includes five functional genes and two pseudogenes. The order of genes is: 5' - zeta - pseudozeta - mu - pseudoalpha-1 - alpha-2 -alpha-1 - theta1 - 3'. [provided by RefSeq, Nov 2009]

Uniprot Description

HBZ: The zeta chain is an alpha-type chain of mammalian embryonic hemoglobin, synthesized primarily in the yolk sac. Belongs to the globin family.

Chromosomal Location of Human Ortholog: 16p13.3

Cellular Component: hemoglobin complex

Molecular Function: protein binding; iron ion binding; heme binding; oxygen binding; oxygen transporter activity

Biological Process: erythrocyte maturation; oxygen transport; negative regulation of transcription from RNA polymerase II promoter

Research Articles on HBZ

Similar Products

Product Notes

The HBZ hbz (Catalog #AAA967274) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-142aa; Full Length. The amino acid sequence is listed below: SLTKTERTII VSMWAKISTQ ADTIGTETLE RLFLSHPQTK TYFPHFDLHP GSAQLRAHGS KVVAAVGDAV KSIDDIGGAL SKLSELHAYI LRVDPVNFKL LSHCLLVTLA ARFPADFTAE AHAAWDKFLS VVSSVLTEKY R. It is sometimes possible for the material contained within the vial of "Hemoglobin subunit zeta (HBZ), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.