Rabbit anti-Human CD79B Polyclonal Antibody | anti-CD79B antibody

CD79B (B Cell Antigen Receptor Complex-associated Protein beta Chain, B Cell-specific Glycoprotein B29, Ig-beta, Immunoglobulin-associated B29 Protein, B29, IGB) (HRP)

Cat. Num. AAA6373283

• Gene Names: CD79B; B29; IGB; AGM6
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CD79B; Polyclonal Antibody; CD79B (B Cell Antigen Receptor Complex-associated Protein beta Chain; B Cell-specific Glycoprotein B29; Ig-beta; Immunoglobulin-associated B29 Protein; B29; IGB) (HRP); anti-CD79B antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human CD79B.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).

• Applicable Applications for anti-CD79B antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human CD79B, aa1-229 (NP_000617.1).
• Immunogen Sequence: MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
• Conjugate: HRP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CD79B expression in transfected 293T cell line by CD79B polyclonal antibody. Lane 1: CD79B transfected lysate (26kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-CD79B antibody

The CD79 molecule, comprising two polypeptide chains, mb-1 (CD79a) and B29 (CD79b), is physically associated in the B-cell membrane with immunoglobulins to constitute the B cell antigen receptor (BCR). The CD79a/b heterodimer interacts with at least one tyrosine kinase (Lyn). Induction of tyrosine kinase activity after antigen binding causes phosphorylation of the CD79a/b dimer, and also of other molecules, thereby initiating intracellular signaling. Almost all acute lymphoblastic leukemias of precursor B cell type are positive when tested with CD79a antibodies.

Product Categories/Family for anti-CD79B antibody

Antibodies; CD Markers

NCBI and Uniprot Product Information

• NCBI GI #: 11038674
• NCBI GeneID: 974
• NCBI Accession #: NP_000617.1
• NCBI GenBank Nucleotide #: NM_000626
• UniProt Accession #: P40259; Q53FS2; Q9BU06
• Molecular Weight: 26,119 Da
• NCBI Official Full Name: B-cell antigen receptor complex-associated protein beta chain isoform 1
• NCBI Official Synonym Full Names: CD79b molecule, immunoglobulin-associated beta
• NCBI Official Symbol: CD79B
• NCBI Official Synonym Symbols: B29; IGB; AGM6
• NCBI Protein Information: B-cell antigen receptor complex-associated protein beta chain; B-cell-specific glycoprotein B29; CD79b antigen (immunoglobulin-associated beta); Ig-beta; immunoglobulin-associated B29 protein
• UniProt Protein Name: B-cell antigen receptor complex-associated protein beta chain
• Protein Family: B-cell antigen receptor complex-associated protein
• UniProt Gene Name: CD79B
• UniProt Synonym Gene Names: B29; IGB
• UniProt Entry Name: CD79B_HUMAN

NCBI Description

The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-beta protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

Ig-beta: Required in cooperation with CD79A for initiation of the signal transduction cascade activated by the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. Enhances phosphorylation of CD79A, possibly by recruiting kinases which phosphorylate CD79A or by recruiting proteins which bind to CD79A and protect it from dephosphorylation. Defects in CD79B are the cause of agammaglobulinemia type 6 (AGM6). It is a primary immunodeficiency characterized by profoundly low or absent serum antibodies and low or absent circulating B-cells due to an early block of B-cell development. Affected individuals develop severe infections in the first years of life. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, misc.; Membrane protein, integral

Chromosomal Location of Human Ortholog: 17q23

Cellular Component: nucleoplasm; Golgi apparatus; integral to plasma membrane; cytoplasm; plasma membrane; B cell receptor complex; external side of plasma membrane

Molecular Function: transmembrane receptor activity

Biological Process: B cell receptor signaling pathway; immune response; signal transduction

Disease: Agammaglobulinemia 6, Autosomal Recessive