Mouse anti-Human CD79B Monoclonal Antibody | anti-CD79B antibody

CD79B (B Cell Antigen Receptor Complex-associated Protein beta Chain, B Cell-specific Glycoprotein B29, Ig-beta, Immunoglobulin-associated B29 Protein, B29, IGB) (AP)

Cat. Num. AAA6130472

• Gene Names: CD79B; B29; IGB; AGM6
• Reactivity: Human
• Applications: ELISA, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CD79B; Monoclonal Antibody; CD79B (B Cell Antigen Receptor Complex-associated Protein beta Chain; B Cell-specific Glycoprotein B29; Ig-beta; Immunoglobulin-associated B29 Protein; B29; IGB) (AP); anti-CD79B antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 4E10-2A10
• Specificity: Recognizes human CD79B.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
• Sequence Length: 1202

• Applicable Applications for anti-CD79B antibody: ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-229 from human CD79B (AAH32651) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (50.93kD).)

Western Blot (WB)

(CD79B monoclonal antibody, Western Blot analysis of CD79B expression in Hela.)

Immunoprecipitation (IP)

(Immunoprecipitation of CD79B transfected lysate using CD79B monoclonal antibody and Protein A Magnetic Bead and immunoblotted with CD79B rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged CD79B is ~0.03ng/ml as a capture antibody.)

Related Product Information for anti-CD79B antibody

The CD79 molecule, comprising two polypeptide chains, mb-1 (CD79a) and B29 (CD79b), is physically associated in the B-cell membrane with immunoglobulins to constitute the B cell antigen receptor (BCR). The CD79a/b heterodimer interacts with at least one tyrosine kinase (Lyn). Induction of tyrosine kinase activity after antigen binding causes phosphorylation of the CD79a/b dimer, and also of other molecules, thereby initiating intracellular signaling. Almost all acute lymphoblastic leukemias of precursor B cell type are positive when tested with CD79a antibodies.

Product Categories/Family for anti-CD79B antibody

Antibodies; CD Markers

NCBI and Uniprot Product Information

• NCBI GI #: 1431167903
• NCBI GeneID: 974
• NCBI Official Full Name: Homo sapiens CD79b molecule, immunoglobulin-associated beta, mRNA
• NCBI Official Synonym Full Names: CD79b molecule
• NCBI Official Symbol: CD79B
• NCBI Official Synonym Symbols: B29; IGB; AGM6
• NCBI Protein Information: B-cell antigen receptor complex-associated protein beta chain
• Protein Family: B-cell antigen receptor complex-associated protein

NCBI Description

The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-beta protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]