Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CD69 AntibodyTitration: 1.0 ug/mlPositive Control: HCT15 Whole Cell)

Rabbit CD69 Polyclonal Antibody | anti-CD69 antibody

CD69 antibody - middle region

Gene Names
CD69; AIM; EA1; MLR-3; CLEC2C; GP32/28; BL-AC/P26
Reactivity
Dog, Guinea Pig, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CD69; Polyclonal Antibody; CD69 antibody - middle region; anti-CD69 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKK
Sequence Length
199
Applicable Applications for anti-CD69 antibody
Western Blot (WB)
Homology
Dog: 86%; Guinea Pig: 86%; Human: 100%; Mouse: 86%; Rat: 93%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CD69 AntibodyTitration: 1.0 ug/mlPositive Control: HCT15 Whole Cell)

Western Blot (WB) (WB Suggested Anti-CD69 AntibodyTitration: 1.0 ug/mlPositive Control: HCT15 Whole Cell)
Related Product Information for anti-CD69 antibody
This is a rabbit polyclonal antibody against CD69. It was validated on Western Blot

Target Description: This gene encodes a member of the calcium dependent lectin superfamily of type II transmembrane receptors. Expression of the encoded protein is induced upon activation of T lymphocytes, and may play a role in proliferation. Furthermore, the protein may act to transmit signals in natural killer cells and platelets.
Product Categories/Family for anti-CD69 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
969
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22kDa
NCBI Official Full Name
early activation antigen CD69
NCBI Official Synonym Full Names
CD69 molecule
NCBI Official Symbol
CD69
NCBI Official Synonym Symbols
AIM; EA1; MLR-3; CLEC2C; GP32/28; BL-AC/P26
NCBI Protein Information
early activation antigen CD69
UniProt Protein Name
Early activation antigen CD69
Protein Family
UniProt Gene Name
CD69
UniProt Synonym Gene Names
CLEC2C; AIM
UniProt Entry Name
CD69_HUMAN

NCBI Description

This gene encodes a member of the calcium dependent lectin superfamily of type II transmembrane receptors. Expression of the encoded protein is induced upon activation of T lymphocytes, and may play a role in proliferation. Furthermore, the protein may act to transmit signals in natural killer cells and platelets. [provided by RefSeq, Aug 2011]

Uniprot Description

Function: Involved in lymphocyte proliferation and functions as a signal transmitting receptor in lymphocytes, natural killer (NK) cells, and platelets.

Subunit structure: Homodimer; disulfide-linked. Ref.6 Ref.7 Ref.8

Subcellular location: Membrane; Single-pass type II membrane protein.

Tissue specificity: Expressed on the surface of activated T-cells, B-cells, natural killer cells, neutrophils, eosinophils, epidermal Langerhans cells and platelets.

Developmental stage: Earliest inducible cell surface glycoprotein acquired during lymphoid activation.

Induction: By antigens, mitogens or activators of PKC on the surface of T and B-lymphocytes. By interaction of IL-2 with the p75 IL-2R on the surface of NK cells.

Post-translational modification: Constitutive Ser/Thr phosphorylation in both mature thymocytes and activated T-lymphocytes.

Sequence similarities: Contains 1 C-type lectin domain.

Research Articles on CD69

Similar Products

Product Notes

The CD69 cd69 (Catalog #AAA3215851) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD69 antibody - middle region reacts with Dog, Guinea Pig, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CD69 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CD69 cd69 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FISTVKRSWT SAQNACSEHG ATLAVIDSEK DMNFLKRYAG REEHWVGLKK. It is sometimes possible for the material contained within the vial of "CD69, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.