Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of CCS expression in transfected 293T cell line by CCS polyclonal antibody. Lane 1: CCS transfected lysate (29kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human CCS Polyclonal Antibody | anti-CCS antibody

CCS (Copper Chaperone for Superoxide Dismutase, Superoxide Dismutase Copper Chaperone) (Biotin)

Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CCS; Polyclonal Antibody; CCS (Copper Chaperone for Superoxide Dismutase; Superoxide Dismutase Copper Chaperone) (Biotin); anti-CCS antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CCS.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
1068
Applicable Applications for anti-CCS antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human CCS, aa1-274 (NP_005116.1).
Immunogen Sequence
MASDSGNQGTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPSQEVQALLEGTGRQAVLKGMGSGQLQNLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGLFQNPKQICSCDGLTIWEERGRPIAGKGRKESAQPPAHL
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CCS expression in transfected 293T cell line by CCS polyclonal antibody. Lane 1: CCS transfected lysate (29kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CCS expression in transfected 293T cell line by CCS polyclonal antibody. Lane 1: CCS transfected lysate (29kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-CCS antibody
Copper chaperone for superoxide dismutase specifically delivers Cu to copper/zinc superoxide dismutase and may activate copper/zinc superoxide dismutase through direct insertion of the Cu cofactor.
Product Categories/Family for anti-CCS antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens copper chaperone for superoxide dismutase (CCS), mRNA
NCBI Official Synonym Full Names
copper chaperone for superoxide dismutase
NCBI Official Symbol
CCS
NCBI Protein Information
copper chaperone for superoxide dismutase
UniProt Protein Name
Copper chaperone for superoxide dismutase
UniProt Gene Name
CCS
UniProt Entry Name
CCS_HUMAN

NCBI Description

Copper chaperone for superoxide dismutase specifically delivers Cu to copper/zinc superoxide dismutase and may activate copper/zinc superoxide dismutase through direct insertion of the Cu cofactor. [provided by RefSeq, Jul 2008]

Uniprot Description

CCS: Delivers copper to copper zinc superoxide dismutase (SOD1).

Chromosomal Location of Human Ortholog: 11q13

Cellular Component: cytoplasm; nucleus; cytosol

Molecular Function: copper ion transmembrane transporter activity; protein binding; copper ion binding; zinc ion binding; superoxide dismutase activity; protein disulfide oxidoreductase activity

Biological Process: response to reactive oxygen species; removal of superoxide radicals; superoxide metabolic process; intracellular copper ion transport; positive regulation of oxidoreductase activity

Research Articles on CCS

Similar Products

Product Notes

The CCS ccs (Catalog #AAA6372709) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CCS (Copper Chaperone for Superoxide Dismutase, Superoxide Dismutase Copper Chaperone) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CCS can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CCS ccs for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CCS, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.