Mouse anti-Human Porimin Monoclonal Antibody | anti-TMEM123 antibody

Porimin (Keratinocytes-associated Transmembrane Protein 3, KCT-3, Pro-oncosis Receptor Inducing Membrane Injury, Transmembrane Protein 123, TMEM123, KCT3, PSEC0111, UNQ641/PRO1271) (AP)

Cat. Num. AAA6133064

• Gene Names: TMEM123; KCT3; PORMIN; PORIMIN
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: Porimin; Monoclonal Antibody; Porimin (Keratinocytes-associated Transmembrane Protein 3; KCT-3; Pro-oncosis Receptor Inducing Membrane Injury; Transmembrane Protein 123; TMEM123; KCT3; PSEC0111; UNQ641/PRO1271) (AP); anti-TMEM123 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1F4
• Specificity: Recognizes human Porimin.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-TMEM123 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa34-134 from human PORIMIN (NP_443164) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: ETLQHVPSDHTNETSNSTVKPPTSVASDSSNTTVTTMKPTAASNTTTPGMVSTNMTSTTLKSTPKTTSVSQNTSQISTSTMTVTHNSSVTSAASSVTITT
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Related Product Information for anti-TMEM123 antibody

Implicated in oncotic cell death, characterized by cell swelling, organelle swelling, vacuolization and increased membrane permeability.

Product Categories/Family for anti-TMEM123 antibody

Antibodies; Membrane Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 100913218
• NCBI GeneID: 114908
• NCBI Accession #: NP_443164
• NCBI GenBank Nucleotide #: NM_052932
• UniProt Accession #: Q8N131
• Molecular Weight: 19kDa
• NCBI Official Full Name: porimin
• NCBI Official Synonym Full Names: transmembrane protein 123
• NCBI Official Symbol: TMEM123
• NCBI Official Synonym Symbols: KCT3; PORMIN; PORIMIN
• NCBI Protein Information: porimin
• UniProt Protein Name: Porimin
• Protein Family: Porimin
• UniProt Gene Name: TMEM123
• UniProt Synonym Gene Names: KCT3; KCT-3
• UniProt Entry Name: PORIM_HUMAN

NCBI Description

This gene encodes a highly glycosylated transmembrane protein with a high content of threonine and serine residues in its extracellular domain, similar to a broadly defined category of proteins termed mucins. Exposure of some cell types to anti-PORIMIN (pro-oncosis receptor inducing membrane injury) antibody, crosslinks this protein on the cell surface and induces a type of cell death termed oncosis. Oncosis is distinct from apoptosis and is characterized by a loss of cell membrane integrity without DNA fragmentation. This gene product is proposed to function as a cell surface receptor that mediates cell death. [provided by RefSeq, Jul 2008]

Uniprot Description

TMEM123: Implicated in oncotic cell death, characterized by cell swelling, organelle swelling, vacuolization and increased membrane permeability. Belongs to the CD164 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell adhesion; Membrane protein, integral

Chromosomal Location of Human Ortholog: 11q22.1

Cellular Component: integral to membrane; external side of plasma membrane

Molecular Function: receptor activity