Mouse anti-Human SCN3A Monoclonal Antibody | anti-SCN3A antibody

SCN3A (Sodium Channel Protein Type 3 Subunit alpha, Sodium Channel Protein Brain III Subunit alpha, Sodium Channel Protein Type III Subunit alpha, Voltage-gated Sodium Channel Subtype III, Voltage-gated Sodium Channel Subunit alpha Nav1.3, KIAA1356, NAC3)

Cat. Num. AAA6005508

• Gene Names: SCN3A; NAC3; Nav1.3
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: SCN3A; Monoclonal Antibody; SCN3A (Sodium Channel Protein Type 3 Subunit alpha; Sodium Channel Protein Brain III Subunit alpha; Sodium Channel Protein Type III Subunit alpha; Voltage-gated Sodium Channel Subtype III; Voltage-gated Sodium Channel Subunit alpha Nav1.3; KIAA1356; NAC3); Anti -SCN3A (Sodium Channel Protein Type 3 Subunit alpha; anti-SCN3A antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 3F3
• Specificity: Recognizes human SCN3A.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: LCESGEMDALRIQMEDRFMASNPSKVSYEPITTTLKRKQEEVSAAIIQRNFRCYLLKQRLKNISSNYNKEAIKGRIDLPIKQDMIIDKLNGNSTPEKTDG*

• Applicable Applications for anti-SCN3A antibody: ELISA (EL/EIA), Western Blot (WB)
• Application Notes: Suitable for use in ELISA and Western Blot.
• Immunogen: Partial recombinant corresponding to aa1861-1961 from human SCN3A (NP_008853) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Testing Data

(Detection limit for recombinant GST tagged SCN3A is ~0.3ng/ml as a capture antibody.)

Related Product Information for anti-SCN3A antibody

Mediates the voltage-dependent sodium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a sodium-selective channel through which Na+ ions may pass in accordance with their electrochemical gradient.

Product Categories/Family for anti-SCN3A antibody

Antibodies; Abs to Ion Channel

NCBI and Uniprot Product Information

• NCBI GI #: 126362955
• NCBI GeneID: 6328
• NCBI Accession #: NP_001075146.1
• NCBI GenBank Nucleotide #: NM_001081677.1
• UniProt Accession #: Q9NY46; Q16142; Q53SX0; Q9BZB3; Q9C006; Q9NYK2; Q9P2J1; Q9UPD1; Q9Y6P4
• Molecular Weight: 226,294 Da
• NCBI Official Full Name: sodium channel protein type 3 subunit alpha isoform 3
• NCBI Official Synonym Full Names: sodium channel, voltage-gated, type III, alpha subunit
• NCBI Official Symbol: SCN3A
• NCBI Official Synonym Symbols: NAC3; Nav1.3
• NCBI Protein Information: sodium channel protein type 3 subunit alpha; brain III voltage-gated sodium channel; voltage-gated sodium channel subtype III; sodium channel protein type III subunit alpha; sodium channel protein brain III subunit alpha; voltage-gated sodium channel subunit alpha Nav1.3; sodium channel, voltage-gated, type III, alpha polypeptide
• UniProt Protein Name: Sodium channel protein type 3 subunit alpha
• Protein Family: Sodium channel protein
• UniProt Gene Name: SCN3A
• UniProt Synonym Gene Names: KIAA1356; NAC3
• UniProt Entry Name: SCN3A_HUMAN

NCBI Description

Voltage-gated sodium channels are transmembrane glycoprotein complexes composed of a large alpha subunit with 24 transmembrane domains and one or more regulatory beta subunits. They are responsible for the generation and propagation of action potentials in neurons and muscle. This gene encodes one member of the sodium channel alpha subunit gene family, and is found in a cluster of five alpha subunit genes on chromosome 2. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

SCN3A: Mediates the voltage-dependent sodium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a sodium-selective channel through which Na(+) ions may pass in accordance with their electrochemical gradient. Belongs to the sodium channel (TC 1.A.1.10) family. Nav1.3/SCN3A subfamily. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Channel, sodium; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 2q24

Cellular Component: voltage-gated sodium channel complex; cytoplasm; plasma membrane

Molecular Function: voltage-gated sodium channel activity

Biological Process: sodium ion transport; generation of action potential