Rabbit anti-Human CCS Polyclonal Antibody | anti-CCS antibody

CCS (Copper Chaperone for Superoxide Dismutase, Superoxide Dismutase Copper Chaperone) (FITC)

Cat. Num. AAA6372710

• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CCS; Polyclonal Antibody; CCS (Copper Chaperone for Superoxide Dismutase; Superoxide Dismutase Copper Chaperone) (FITC); anti-CCS antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human CCS.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
• Sequence Length: 1068

• Applicable Applications for anti-CCS antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human CCS, aa1-274 (NP_005116.1).
• Immunogen Sequence: MASDSGNQGTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPSQEVQALLEGTGRQAVLKGMGSGQLQNLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGLFQNPKQICSCDGLTIWEERGRPIAGKGRKESAQPPAHL
• Conjugate: FITC
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CCS expression in transfected 293T cell line by CCS polyclonal antibody. Lane 1: CCS transfected lysate (29kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-CCS antibody

Copper chaperone for superoxide dismutase specifically delivers Cu to copper/zinc superoxide dismutase and may activate copper/zinc superoxide dismutase through direct insertion of the Cu cofactor.

Product Categories/Family for anti-CCS antibody

Antibodies; Superoxide Dismutase

NCBI and Uniprot Product Information

• NCBI GI #: 4826664
• NCBI GeneID: 9973
• NCBI Accession #: NM_005125.1
• NCBI GenBank Nucleotide #: NM_005125.1
• UniProt Accession #: O14618
• NCBI Official Full Name: Homo sapiens copper chaperone for superoxide dismutase (CCS), mRNA
• NCBI Official Synonym Full Names: copper chaperone for superoxide dismutase
• NCBI Official Symbol: CCS
• NCBI Protein Information: copper chaperone for superoxide dismutase
• UniProt Protein Name: Copper chaperone for superoxide dismutase
• Protein Family: Capsanthin/capsorubin synthase
• UniProt Gene Name: CCS
• UniProt Entry Name: CCS_HUMAN

NCBI Description

Copper chaperone for superoxide dismutase specifically delivers Cu to copper/zinc superoxide dismutase and may activate copper/zinc superoxide dismutase through direct insertion of the Cu cofactor. [provided by RefSeq, Jul 2008]

Uniprot Description

CCS: Delivers copper to copper zinc superoxide dismutase (SOD1).

Chromosomal Location of Human Ortholog: 11q13

Cellular Component: cytoplasm; nucleus; cytosol

Molecular Function: copper ion transmembrane transporter activity; protein binding; copper ion binding; zinc ion binding; superoxide dismutase activity; protein disulfide oxidoreductase activity

Biological Process: response to reactive oxygen species; removal of superoxide radicals; superoxide metabolic process; intracellular copper ion transport; positive regulation of oxidoreductase activity