Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using CCR4 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 120s.)

Rabbit anti-Human CCR4 Polyclonal Antibody | anti-CCR4 antibody

CCR4 Rabbit pAb

Gene Names
CCR4; CKR4; K5-5; CD194; CMKBR4; ChemR13; CC-CKR-4; HGCN:14099
Reactivity
Human
Applications
Western Blot
Purity
Affinity purification
Synonyms
CCR4; Polyclonal Antibody; CCR4 Rabbit pAb; CC-CKR-4; CD194; CKR4; CMKBR4; ChemR13; HGCN:14099; K5-5; anti-CCR4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MNPTDIADTTLDESIYSNYYLYESIPKPCTKEGIKAFGELFLPPLYSLVFVFGLLGNSVVVLVLFKYKRLRSMTDVYLLNLAISDLLFVFSLPFWGYYAA
Applicable Applications for anti-CCR4 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CCR4 (NP_005499.1).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using CCR4 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 120s.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using CCR4 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 120s.)
Related Product Information for anti-CCR4 antibody
Background: The protein encoded by this gene belongs to the G-protein-coupled receptor family. It is a receptor for the CC chemokine - MIP-1, RANTES, TARC and MCP-1. Chemokines are a group of small polypeptide, structurally related molecules that regulate cell trafficking of various types of leukocytes. The chemokines also play fundamental roles in the development, homeostasis, and function of the immune system, and they have effects on cells of the central nervous system as well as on endothelial cells involved in angiogenesis or angiostasis.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41,403 Da
NCBI Official Full Name
C-C chemokine receptor type 4
NCBI Official Synonym Full Names
chemokine (C-C motif) receptor 4
NCBI Official Symbol
CCR4
NCBI Official Synonym Symbols
CKR4; K5-5; CD194; CMKBR4; ChemR13; CC-CKR-4; HGCN:14099
NCBI Protein Information
C-C chemokine receptor type 4; CCR-4; C-C CKR-4; chemokine (C-C) receptor 4
UniProt Protein Name
C-C chemokine receptor type 4
Protein Family
UniProt Gene Name
CCR4
UniProt Synonym Gene Names
CMKBR4; C-C CKR-4; CC-CKR-4; CCR-4; CCR4
UniProt Entry Name
CCR4_HUMAN

NCBI Description

The protein encoded by this gene belongs to the G-protein-coupled receptor family . It is a receptor for the CC chemokine - MIP-1, RANTES, TARC and MCP-1. Chemokines are a group of small polypeptide, structurally related molecules that regulate cell trafficking of various types of leukocytes. The chemokines also play fundamental roles in the development, homeostasis, and function of the immune system, and they have effects on cells of the central nervous system as well as on endothelial cells involved in angiogenesis or angiostasis. [provided by RefSeq, Jul 2008]

Uniprot Description

CCR4: High affinity receptor for the C-C type chemokines CCL17/TARC and CCL22/MDC. The activity of this receptor is mediated by G(i) proteins which activate a phosphatidylinositol- calcium second messenger system. Can function as a chemoattractant homing receptor on circulating memory lymphocytes and as a coreceptor for some primary HIV-2 isolates. In the CNS, could mediate hippocampal-neuron survival. Belongs to the G-protein coupled receptor 1 family.

Protein type: Receptor, GPCR; GPCR, family 1; Membrane protein, integral; Motility/polarity/chemotaxis; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 3p24

Cellular Component: cell soma; integral to plasma membrane; plasma membrane; external side of plasma membrane

Molecular Function: C-C chemokine receptor activity; chemokine receptor activity

Biological Process: response to antibiotic; G-protein coupled receptor protein signaling pathway; response to radiation; elevation of cytosolic calcium ion concentration; positive regulation of positive chemotaxis; response to bacterium; neuron migration; immune response; chemotaxis; inflammatory response; tolerance induction

Research Articles on CCR4

Similar Products

Product Notes

The CCR4 ccr4 (Catalog #AAA9142717) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CCR4 Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CCR4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the CCR4 ccr4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MNPTDIADTT LDESIYSNYY LYESIPKPCT KEGIKAFGEL FLPPLYSLVF VFGLLGNSVV VLVLFKYKRL RSMTDVYLLN LAISDLLFVF SLPFWGYYAA. It is sometimes possible for the material contained within the vial of "CCR4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.