Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-SLC1A3 Polyclonal Antibody)

Rabbit SLC1A3 Polyclonal Antibody | anti-SLC1A3 antibody

SLC1A3 Polyclonal Antibody

Gene Names
SLC1A3; EA6; EAAT1; GLAST; GLAST1
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purification
Synonyms
SLC1A3; Polyclonal Antibody; SLC1A3 Polyclonal Antibody; EA6; EAAT1; GLAST; GLAST1; solute carrier family 1 member 3; anti-SLC1A3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
2.6 mg/ml (varies by lot)
Sequence Length
496
Applicable Applications for anti-SLC1A3 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
WB: 1:500-1:2000
IHC: 1:100-1:200
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 453-542 of human SLC1A3 (NP_004163.3).
Immunogen Sequence
IVLTSVGLPTDDITLIIAVDWFLDRLRTTTNVLGDSLGAGIVEHLSRHELKNRDVEMGNSVIEENEMKKPYQLIAQDNETEKPIDSETKM
Positive Samples
293T, U-251MG, HeLa, H460, C6, Rat Lung
Cellular Location
Membrane, Multi-Pass Membrane Protein
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-SLC1A3 Polyclonal Antibody)

Western Blot (WB) (Western blot-SLC1A3 Polyclonal Antibody)
Related Product Information for anti-SLC1A3 antibody
This gene encodes a member of a member of a high affinity glutamate transporter family. This gene functions in the termination of excitatory neurotransmission in central nervous system. Mutations are associated with episodic ataxia, Type 6. Alternative splicing results in multiple transcript variants.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 55kDa; 59kDa
Observed: 70kDa
NCBI Official Full Name
excitatory amino acid transporter 1 isoform 4
NCBI Official Synonym Full Names
solute carrier family 1 member 3
NCBI Official Symbol
SLC1A3
NCBI Official Synonym Symbols
EA6; EAAT1; GLAST; GLAST1
NCBI Protein Information
excitatory amino acid transporter 1
UniProt Protein Name
Excitatory amino acid transporter 1
UniProt Gene Name
SLC1A3
UniProt Synonym Gene Names
EAAT1; GLAST; GLAST1; GLAST-1
UniProt Entry Name
EAA1_HUMAN

NCBI Description

This gene encodes a member of a member of a high affinity glutamate transporter family. This gene functions in the termination of excitatory neurotransmission in central nervous system. Mutations are associated with episodic ataxia, Type 6. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Feb 2014]

Uniprot Description

SLC1A3: Transports L-glutamate and also L- and D-aspartate. Essential for terminating the postsynaptic action of glutamate by rapidly removing released glutamate from the synaptic cleft. Acts as a symport by cotransporting sodium. Highly expressed in cerebellum, but also found in frontal cortex, hippocampus and basal ganglia. Belongs to the sodium:dicarboxylate (SDF) symporter (TC 2.A.23) family. SLC1A3 subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transporter; Mitochondrial; Transporter, SLC family; Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 5p13

Cellular Component: cell surface; cell projection; membrane; cell soma; fibril; integral to membrane; plasma membrane

Molecular Function: glutamate binding; high-affinity glutamate transmembrane transporter activity; sodium:dicarboxylate symporter activity; L-glutamate transmembrane transporter activity

Biological Process: response to drug; response to light stimulus; cranial nerve development; auditory behavior; glutamate biosynthetic process; positive regulation of synaptic transmission; response to antibiotic; L-glutamate import; synaptic transmission; sensory perception of sound; neuron morphogenesis during differentiation; gamma-aminobutyric acid biosynthetic process; response to wounding; neurotransmitter uptake; ion transport; neuromuscular process controlling balance; transmembrane transport

Disease: Episodic Ataxia, Type 6

Research Articles on SLC1A3

Similar Products

Product Notes

The SLC1A3 slc1a3 (Catalog #AAA9140453) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC1A3 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SLC1A3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). WB: 1:500-1:2000 IHC: 1:100-1:200. Researchers should empirically determine the suitability of the SLC1A3 slc1a3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC1A3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.