Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CC2D2A AntibodyTitration: 1.0 ug/mlPositive Control: MDA-MB-435S Whole Cell)

Rabbit CC2D2A Polyclonal Antibody | anti-CC2D2A antibody

CC2D2A Antibody - N-terminal region

Gene Names
CC2D2A; MKS6; JBTS9
Reactivity
Guinea Pig, Human, Mouse
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CC2D2A; Polyclonal Antibody; CC2D2A Antibody - N-terminal region; anti-CC2D2A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Guinea Pig, Human, Mouse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EDADMGRQNKNSKVRRQPRKKQKPTPFSRACWQILPHLSAGVPLLGWEHP
Sequence Length
122
Applicable Applications for anti-CC2D2A antibody
Western Blot (WB)
Homology
Guinea Pig: 77%; Human: 100%; Mouse: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human CC2D2A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CC2D2A AntibodyTitration: 1.0 ug/mlPositive Control: MDA-MB-435S Whole Cell)

Western Blot (WB) (WB Suggested Anti-CC2D2A AntibodyTitration: 1.0 ug/mlPositive Control: MDA-MB-435S Whole Cell)
Related Product Information for anti-CC2D2A antibody
This is a rabbit polyclonal antibody against CC2D2A. It was validated on Western Blot

Target Description: This gene encodes a coiled-coil and calcium binding domain protein that appears to play a critical role in cilia formation. Mutations in this gene cause Meckel syndrome type 6, as well as Joubert syndrome type 9. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-CC2D2A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14kDa
NCBI Official Full Name
coiled-coil and C2 domain-containing protein 2A isoform b
NCBI Official Synonym Full Names
coiled-coil and C2 domain containing 2A
NCBI Official Symbol
CC2D2A
NCBI Official Synonym Symbols
MKS6; JBTS9
NCBI Protein Information
coiled-coil and C2 domain-containing protein 2A

NCBI Description

This gene encodes a coiled-coil and calcium binding domain protein that appears to play a critical role in cilia formation. Mutations in this gene cause Meckel syndrome type 6, as well as Joubert syndrome type 9. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2009]

Research Articles on CC2D2A

Similar Products

Product Notes

The CC2D2A (Catalog #AAA3216845) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CC2D2A Antibody - N-terminal region reacts with Guinea Pig, Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's CC2D2A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CC2D2A for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EDADMGRQNK NSKVRRQPRK KQKPTPFSRA CWQILPHLSA GVPLLGWEHP. It is sometimes possible for the material contained within the vial of "CC2D2A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.